KEGG   Cicer arietinum (chickpea): 101507549Help
Entry
101507549         CDS       T02819                                 

Definition
(RefSeq) beta-amyrin synthase
  KO
K15813  beta-amyrin synthase [EC:5.4.99.39]
Organism
cam  Cicer arietinum (chickpea)
Pathway
cam00909  Sesquiterpenoid and triterpenoid biosynthesis
cam01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cam00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    101507549
Enzymes [BR:cam01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.39  beta-amyrin synthase
     101507549
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SQHop_cyclase_C SQHop_cyclase_N Prenyltrans Pec_lyase TED_complement BsuPI
Motif
Other DBs
NCBI-GeneID: 101507549
NCBI-ProteinID: XP_004488915
UniProt: A0A3Q7Y1E0
Position
Ca1
AA seq 762 aa AA seqDB search
MWRLKIADGGKDPYIFSTNEFVGRQIWEYDSEAGSKEEREQVEQARLNFYNNRFQVKPCA
DLLWRFQVLRENNFKQTIDSVKIEDGEEITYEKATSALRRGTHHLAALQTSDGHWPAQIA
GPLFFLPPLVFCVYITGHLDSVFSEEHRKEILRYIYCHQNEDGGWGLHIEGHSTMFCTAL
NYICMRILGEGPNGGLDNACARARKWIRDHGGVTHIPSWGKTWLSILGVFDWCGSNPMPP
EFWILPSFLPMHPAKMWCYCRLVYMPMSYLYGKRFVGPITPLILQLREELHTQPYEKINW
TKARHLCAKEDLYYPHPFIQDLIWDSLYIFTEPFLTRWPFNKLIREKALEVTMKHIHYED
ENSRYITIGCVEKVLCMLACWVEDPNGDAFKKHLARIPDYLWISEDGMTMQSFGSQEWDA
GFAVQALLATNLIEEIGPALAKGHDFIKKSQVRENPSGDFKSMHRHISKGSWTFSDQDHG
WQVSDCTAEGLKCCLLLSMLPPEVVGEKMEPERLYDSVNLLLSLQSKKGGLAAWEPAGAQ
EWLELLNPTEFFADIVVEHEYVECTGSAIQALVLFKKLYPGHRKKEIENFIVNAVRFLED
TQTSNGSWYGNWGVCFTYGTWFALGGLAAAGKTFTNCSAIRKAVQFLLTTQRDDGGWGES
YLSSPKKIYVPLERSRSNVVHTAWALMGLIHAGQAEINPTPLHRAAKLLINSQLEEGDWP
QQEITGVFMKNCMLHYPMYRDIYPLWALAEYRRRVPLPSTTV
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
atgtggaggctgaaaatagcagatggagggaaagatccatacatattcagcacaaatgag
tttgtagggagacaaatatgggaatatgattcagaagcaggaagtaaagaagaaagagaa
caagttgaacaagctcgtctcaatttctataacaatcgcttccaagttaaaccttgtgct
gacctcctttggcgttttcaggttctacgagaaaataatttcaaacaaacaatagatagt
gtaaagatagaagatggagaagagataacatatgaaaaagccacaagtgcattgagaagg
ggcacacatcatctagcagcattgcaaaccagtgatggccattggcctgctcaaattgca
ggtcctctctttttccttcctccattggttttttgtgtctatataaccggacatcttgac
tcggtattctcagaagagcatcgcaaagagattctgcgttacatttattgtcatcagaat
gaagatggaggttgggggctacacatagagggtcatagcaccatgttttgtactgcactc
aactatatatgtatgagaattcttggagaagggcctaatggaggtctagacaatgcttgt
gctagagcaagaaagtggattcgtgatcacggtggtgtaacacatataccttcatgggga
aaaacatggctttcgatacttggagtgtttgattggtgtggaagcaacccaatgcctcct
gaattttggatccttccttcatttcttcctatgcatccagctaaaatgtggtgttattgt
cgattggtatacatgcctatgtcttacttgtatgggaagaggtttgtgggtccaatcaca
ccacttattttacagttgagagaagaacttcatactcaaccttatgaaaaaattaattgg
acaaaagcacgtcatctatgtgcaaaggaagatctttactatccacatcctttcatacaa
gatttgatatgggatagcttatacatattcactgagccatttctcactcgatggcctttc
aacaagttgataagagaaaaagctcttgaagtaacaatgaagcatatccactatgaagat
gagaatagtcgatacataaccattgggtgtgtggaaaaggttttatgtatgcttgcttgt
tgggtggaagatccaaatggagatgctttcaagaagcatctagcaaggattccagattat
ttatggatttcagaagatggaatgaccatgcagagttttggtagccaagaatgggatgct
ggttttgctgttcaagctttgcttgccacaaacctaattgaggaaatcggtcctgcactt
gcgaaaggacatgatttcataaagaaatctcaggtcagggaaaacccttccggagatttt
aagagtatgcatcgtcatatttctaaaggttcgtggaccttctccgatcaagaccatgga
tggcaagtttctgattgcaccgcagaaggtttgaagtgttgtctacttttatcaatgttg
cctccagaggttgtgggagaaaagatggaaccagaaaggttatatgattcagtcaatctc
cttttgtcacttcagagtaagaaagggggtttggccgcatgggagccagcaggagctcaa
gaatggttagaactactgaatccgacggagttttttgcggacattgtagttgagcatgaa
tatgtagagtgcacggggtcggcaattcaagctttagttttgttcaaaaaactatatcca
gggcataggaagaaagagatagagaatttcattgtgaatgcagttcgattccttgaagat
acacaaacaagcaatggttcatggtatggaaactggggagtatgcttcacttatggtact
tggttcgctcttggtggtttagcagctgctggaaagacttttaccaattgttctgctatt
cgcaaagctgttcaatttcttcttacaacacaaagagatgatggtgggtggggggagagc
tatctttcaagtccaaaaaagatatatgtacctctagaaagaagtcgatccaatgttgta
catactgcatgggctcttatgggtttaattcacgctggccaggcagagataaaccctact
cctcttcaccgtgctgcaaaattgctcatcaattctcagttagaagaaggggattggccc
caacaggaaatcacaggagtattcatgaaaaattgtatgctgcattatccaatgtacaga
gatatttacccattgtgggctcttgctgagtatcgtagacgggttccattgccttctact
acagtttaa

DBGET integrated database retrieval system