KEGG   Cicer arietinum (chickpea): 101507608Help
Entry
101507608         CDS       T02819                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
cam  Cicer arietinum (chickpea)
Pathway
cam00010  Glycolysis / Gluconeogenesis
cam00562  Inositol phosphate metabolism
cam01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101507608
   00562 Inositol phosphate metabolism
    101507608
Enzymes [BR:cam01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     101507608
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     101507608
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 101507608
NCBI-ProteinID: XP_004500514
UniProt: A0A1S2Y8G9
Position
Ca5
AA seq 495 aa AA seqDB search
MTKTMSLVLVILLFLSVFHFSHAEEPFDVRKHLSTVSRYGVVKDITDNNFIPSKIPEECT
PIHLNLVARHGTRSPTKKRIRELDNLSAHLEVLIRDVKEQKLSLERVPSWLNGWKSPWRG
RLKGGELIRRGEEELYDLGIRIRERFPNLFDEDYHPDIYPIKATQVPRASASAVAFGMGL
FSGNGTLGPGNHRAFAVTSENRASDTLLRFYECCHNYKDFRKRQEPAVDKLKEPILDEIT
SALVGRYGLNFTRQVTSSLWFLCKQEASLLDITDQACSLFSPSEIALLEWTDDLEVYILK
GYGKSLNYRMGMPLLEDVVQSMEQAIKAKEEKHAPGSYEKARLRFAHAETIVPFSCLLGL
FLEGSEFDNIQKEKPLQLPPKPPQKRKWRGSTVAPFGGNNMLVLYSCPTPDKARSKHFVQ
VLHNEHSIPMPGCHGSDFCPFEVFKEKIVAPHRKHDYDTVCNAKLEQKPSGSKIFQIFQW
LFPLGKGDKFPKDEF
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaaacaatgagtcttgttcttgtaatattattattcctttcagtttttcacttc
tcacacgctgaagaaccttttgatgttcgcaaacacctctccactgtctccaggtacggt
gttgtcaaagacattactgataacaactttattccttctaaaattcctgaagaatgtact
ccaatacatttaaatcttgtggcaaggcatggaactcgttctccaacaaagaaaaggatt
agagagttggataatttgtcggctcatctggaagttcttataagggatgtgaaagagcaa
aaattgtctttggagagagttccttcttggctaaatggatggaaatctccttggcgtgga
aggcttaagggtggtgagttaattagaagaggagaggaagaattatatgatcttggaata
aggattagagaaaggtttccaaatttgtttgatgaggattaccatcctgacatatatcca
ataaaggcaactcaggttccccgagcatcagctagtgctgtggcatttggaatgggtctt
ttcagtggcaatggaactcttggacctgggaatcacagggcttttgctgttacaagtgaa
aatcgtgctagtgacaccttgctgagattttatgaatgttgtcataactacaaggatttc
aggaaaaggcaggaacctgcagttgataaacttaaggaacctatcttggatgagattaca
tctgcattagttgggcgttacgggctgaattttacaaggcaggttacatcatctctctgg
ttcttatgtaaacaggaagcatccttgttggatataactgatcaagcgtgtagtcttttc
agcccatctgagattgcattgctggagtggacagatgacttggaggtgtatattctgaag
ggttatggtaaatcactaaattatagaatggggatgccattacttgaagatgttgttcaa
tccatggagcaagctattaaggctaaagaagaaaagcatgctcctggcagctatgaaaaa
gcaagacttcggtttgcacatgctgaaactatagtcccattctcatgtctgcttggttta
tttcttgaagggtctgagtttgacaatattcagaaggagaaacctttgcagctccctcca
aagcctccacagaaaagaaaatggcggggtagcactgtggctccttttggtggtaacaac
atgctggtcctgtatagttgtcctacgccagacaaagctagaagcaagcactttgtgcaa
gtgctgcacaatgaacactccattccaatgccgggttgtcatggttctgatttctgtcca
tttgaagtattcaaggaaaaaatagttgcacctcatcggaagcatgactacgatacagtc
tgtaatgcaaagctagagcagaagccctcgggcagcaagatattccaaatatttcagtgg
ctttttccactagggaaaggtgacaagttccccaaagatgaattttag

DBGET integrated database retrieval system