KEGG   Cicer arietinum (chickpea): 101507890Help
Entry
101507890         CDS       T02819                                 

Definition
(RefSeq) putative ATP-dependent RNA helicase DHX33
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
cam  Cicer arietinum (chickpea)
Pathway
cam03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:cam00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    101507890
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cam03041]
    101507890
Enzymes [BR:cam01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     101507890
Spliceosome [BR:cam03041]
 Complex C
  Other components
   Step II factors
    101507890
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C DEAD AAA_22 AAA_30 T2SSE AAA_19 PhoH DUF2075 ABC_tran
Motif
Other DBs
NCBI-GeneID: 101507890
NCBI-ProteinID: XP_004493676
UniProt: A0A1S2XU51
Position
Ca3
AA seq 714 aa AA seqDB search
MPSVARRSHQPTANGNDKSSNANRNRRQNIAQQKKSLPIASVEKRLIEEVRKNDILIIVG
ETGSGKTTQIPQFLFDAGFCREGKVVGITQPRRVAAVTVAKRVADECGVDLGQKVGYSVR
FDDSTSNSTRIKYMTDGLLLREALLDPYLSKYSVIIVDEAHERTVHTDVLMGLLKNVQLA
RSNSTSDGRHLNNGDKNVNGFMSLDKDNGQNGNFLKKDHRDKSSPLKLIIMSASLDARTF
SEYFGGAKAVHIQGRQFPVDIFYTRHAETDYLDAALITIFQVHLGEAPGDILVFLTGQEE
IEAVERLINERLTKIPEGSRKLLVVPIFAALPSEQQMRAFAPAPSEFRKVILATNIAETS
VTIPGIKYVIDPGLVKARSYDPGKGMESLIVVPTSKSQALQRSGRAGREGPGKCFRLYPE
NEFEKLEDSTMPEIKRCNLSNVILQLKALGVDDILGFDFIEKPSRAAIIKSLEQLFLLGA
LTDDCQLSDPVGRQMARLPLDPVYSKALILASQFNCLEEMLITVAMLSVESIFYTPRDKY
EEARTATKCFGSPEGDHITLINVYRAANDLLEKRTMEMNKMKSEKVLRKWCKENFINSRS
LRHARDIHRQIKGHAEQMGLSLASCGDDMLQFRRCLVASFFLNAAVKQPDGTYRALASGQ
VVQIHPSSVLFRKKPECIIFNELIQTNNKYVRNLTRVDYLWLTELAPQFYAMQN
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgccttcggtggctcgtagaagtcaccaacccactgctaatggcaatgacaagtcctcc
aatgcaaatcggaataggagacaaaatattgcacaacagaagaagtctcttcctattgct
tcggttgagaagagactaattgaagaggttcggaagaatgatattttgattattgttggt
gaaactggaagtggaaaaaccacacagattccgcagtttttatttgatgctggattttgc
cgcgaaggaaaagttgttggcataactcagcctagacgtgttgcagctgtcactgtggcc
aaacgagttgctgatgaatgtggtgttgatttgggccaaaaggttggatactctgttaga
tttgatgattctacttccaactcaacaaggatcaaatatatgacagatggattgctcctg
agggaagcattgctggatccttatctttctaagtattctgttataattgttgatgaagcg
cacgagagaaccgtccacactgatgtcttgatgggcttgctaaaaaatgtccaacttgct
cggtcaaattctaccagcgatggtcggcaccttaataatggggacaagaatgtgaatggt
ttcatgtcattggataaagacaatggtcagaatggcaattttcttaagaaagaccaccgc
gataagagttctccgttgaaattaatcatcatgtctgcaagtcttgatgctcgcactttt
tctgagtactttggtggtgctaaagctgttcacatccaagggagacagttccctgtggat
atattttatactcgccatgcagaaactgactatctagatgctgccttgataacgattttc
caggttcatttaggggaggcccctggtgatatactagtatttcttactgggcaagaagag
attgaagctgttgaaaggcttatcaatgagcgacttacaaagatacctgaaggaagtcgg
aagcttctagttgtgcctatatttgcagctcttccatctgagcagcaaatgcgagccttt
gcaccagctccatctgaatttcgcaaggtgattttggcaaccaatattgctgagacatca
gtaacaattcctggaatcaagtatgtaattgatcctggacttgtaaaagcacgttcctat
gaccccgggaaaggcatggaatctttgattgtagtacctacatccaagtcccaggctttg
caaagaagtgggcgtgcagggcgtgaaggacctggaaaatgctttcgtctatatccagaa
aatgaatttgagaaacttgaggattctacaatgccggaaattaagcgttgcaacctttct
aatgtcattttgcagcttaaggctttgggtgttgatgacatattagggttcgatttcatt
gagaaaccttcaagggcagctattataaaatcattggagcagctatttttattaggtgct
ttaacagatgactgtcaactatctgatccagttggacgtcaaatggcacgactgcccttg
gaccctgtttattccaaagctcttattttagctagtcagtttaattgcttggaagagatg
ttgataactgtggcaatgctttctgtggaatccattttttatactccgcgcgacaagtat
gaagaggcaagaactgcaactaaatgctttggaagtccagagggagaccacatcactttg
attaatgtgtatagagcagctaatgatttattggagaagagaacgatggaaatgaataaa
atgaaaagcgaaaaggttttgagaaaatggtgcaaagaaaattttattaatagccgttct
cttagacatgctcgtgacattcacaggcagattaaaggacatgctgaacaaatgggtctg
agtcttgcttcttgtggagatgatatgcttcaatttcgcagatgccttgttgcttccttt
ttcctcaatgcagctgtgaagcagccagatggaacctacagggcattggcaagtggtcag
gtggtgcagatccacccttcttctgtattgttccggaaaaaaccagagtgcataatattt
aatgaactgatccaaactaataacaagtatgtccgtaatttaaccagagttgactaccta
tggttaaccgaacttgctcctcagttttatgctatgcagaactaa

DBGET integrated database retrieval system