KEGG   Cicer arietinum (chickpea): 101508164Help
Entry
101508164         CDS       T02819                                 

Definition
(RefSeq) (R)-mandelonitrile lyase-like
  KO
K08248  (R)-mandelonitrile lyase [EC:4.1.2.10]
Organism
cam  Cicer arietinum (chickpea)
Pathway
cam00460  Cyanoamino acid metabolism
cam01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cam00001]
 Metabolism
  Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    101508164
Enzymes [BR:cam01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.10  (R)-mandelonitrile lyase
     101508164
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GMC_oxred_N GMC_oxred_C FAD_binding_2 Pyr_redox_2 NAD_binding_8 DAO Pyr_redox_3 FAD_binding_3 Lycopene_cycl HI0933_like
Motif
Other DBs
NCBI-GeneID: 101508164
NCBI-ProteinID: XP_004507539
UniProt: A0A1S2YNL3
Position
Ca6
AA seq 580 aa AA seqDB search
MEKSAITVTTEFLFLTSFITIFIGSAFASPTQNQESNSQEQQDKPPSYLRMVANASEFPL
EDYYDYIIVGGGTAGCPLAATLSQNYRVLVLERGGVTHGKSNLMNQEGFLNTLLNANVNN
ANNEDSPAQSFISEDGVLNARGRVLGGSSAINAGFYSRADHEFFTRSGVIWDSKLVNESY
EWVEREIVFRPQLKTWQSAFRDGLLEARVGPYNGFTLDHATGTKIGGSTFDTSGKRHSSA
DLLRYARHSNLRIAVYASVERILLASSSSSTTTSSETSSSATTSAIGVLYRDQNGKYHHA
ILRGRGEVILAAGAIGSPQLLLLSGIGPRPYLSSWGIPVTHHLPYVGHFLYDNPRNGITF
LPSIPLEHSLIQVVGITNSGAYIEAASNVVPFSSPVRNFFIRESNSPLYLTVATLISKIS
GPVSAGFLRLASTDVRFNPIVRFNYFNNGVDVERCVNGTRKLGEVLRSRAMNDFKFVNWL
GVRDFRFIGPALPNDESDYIEMADFCRRTVSTIWHYHGGCVVGRVVDSHLKVIGIDSLRI
VDGSVFSVSPGTNPQATLMMLGRYFGLKMIREREGYSNDL
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atggagaaatctgccataaccgttacaacagagtttctatttctcacatctttcatcaca
atattcatcggttctgcattcgcttctccaacacaaaatcaagaatctaactctcaagaa
caacaagataagccgccgagttacttaaggatggtggctaacgcaagcgagtttccctta
gaagattactacgattacataatagtcggcggcggaacagccggctgtccattagccgcc
acactctcccaaaattaccgcgtattagtcctcgaacgtggtggagttacccacggtaaa
tccaatttaatgaaccaagaaggtttcttgaacacattattaaacgcaaacgtaaacaac
gccaacaacgaagactcaccggctcaatcattcatttcagaagacggcgtactcaacgca
cgtggccgcgttctcggcggtagtagcgcaattaacgccggcttttatagccgagccgat
cacgaattttttacacgctccggtgttatttgggactcaaaacttgtgaacgaatcttac
gaatgggttgaaagagaaatcgtttttcgtcctcaacttaaaacgtggcaatccgctttt
cgtgatggtcttctagaagctcgtgtgggtccctataacggtttcaccttagatcacgct
actggtaccaaaattggtgggtccacttttgatacttcaggtaaacgacatagttccgca
gatcttttacgctatgcacgacactccaatcttcgcattgccgtttacgctagcgtcgaa
cgaatccttctcgcttcttcatcatcttcaacaacaacgagttctgaaacttcttcttct
gcaacaacttctgcgattggagttctttatcgcgatcaaaacggaaaatatcatcacgcg
attttgagaggacgcggagaagtgattcttgcagcaggtgcaattggaagtccacaactt
cttctattaagtggaattggacctagaccttatctttcttcatggggaataccagtgaca
catcatttaccatacgtaggtcattttctatacgataatccacgtaacggaatcactttt
ctaccttcaattccacttgaacattcgcttatacaagttgtaggtataacgaattcaggt
gcttacatagaagcagcttctaatgttgttccgttttcatcaccggttcggaatttcttc
atccgtgaatctaattcgccgctttatctaactgttgcgacgttgatttcgaagatttca
ggacctgtttctgctggttttctaagattagcttcaactgatgttaggtttaatccaatt
gttaggtttaattactttaacaacggtgttgatgttgaaaggtgtgttaatggaacaagg
aaattaggggaagtacttaggagtagagcaatgaatgattttaagtttgtgaattggtta
ggtgttagagattttaggtttattggacctgctttgcctaatgatgaaagtgattatatt
gaaatggctgatttttgtagaaggactgttagtactatttggcattatcatggtggttgt
gtggttggtagggttgttgattcacatttgaaagtcattggaattgattctcttcggatt
gttgatggttctgtttttagtgtttcacctggaactaatcctcaagctacattaatgatg
ttgggaaggtattttgggctaaagatgattagagaaagggaaggatattcaaatgatttg
taa

DBGET integrated database retrieval system