KEGG   Cicer arietinum (chickpea): 101508565Help
Entry
101508565         CDS       T02819                                 

Definition
(RefSeq) mannose-1-phosphate guanyltransferase alpha-like
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
cam  Cicer arietinum (chickpea)
Pathway
cam00051  Fructose and mannose metabolism
cam00520  Amino sugar and nucleotide sugar metabolism
cam01100  Metabolic pathways
cam01110  Biosynthesis of secondary metabolites
Module
cam_M00114  Ascorbate biosynthesis, plants, glucose-6P => ascorbate
Brite
KEGG Orthology (KO) [BR:cam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    101508565
   00520 Amino sugar and nucleotide sugar metabolism
    101508565
Enzymes [BR:cam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     101508565
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NTP_transferase Hexapep NTP_transf_3 DUF4954
Motif
Other DBs
NCBI-GeneID: 101508565
NCBI-ProteinID: XP_004501963
UniProt: A0A1S2YAJ3
Position
Ca5
AA seq 415 aa AA seqDB search
MGIAEKESVVAVIMVGGPTKGTRFRPLSFKXXXXLFPLAGQPMVHHPISACKKIPNLARI
YLIGFYEEREFALYVSSISNDLKIPVRYLREDKPHGSAGGLYNFRDIIMEEDPSHIFLLN
CDVCCSFPLPQMLDAHKKHGGMGTILVVKVSPESASEFGELVADPLTNELLHYTEKPETF
VSDLINCGVYIFTPDIFTAIEGVSSQWKDRANLRRVSSFEAMQPDTRSLTNYVRLDQDIL
SPLAGKKQLYIYETMDFWEQIKTPGMSIKCSALYLSQFRHTAPHLLANGDGIKKACIIGD
VYIHPSAKVHPSAKIGPGVSISANARIGAGARLINCIVLDDVEIEENAVVLHAIVGWKSS
IGRWARVQGRGDYNAKLGVTILGESVAVEDEVVVINSIVLPHKILNVGVQDEILL
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgggaattgcagagaaggagagtgtggtggcggtgattatggtaggaggaccgacgaaa
ggcactagattccgcccattgtcattcaagnnnnnnnnnnnactctttccattagctgga
caaccaatggttcatcaccctatctccgcttgtaaaaaaattcctaatttggctcgtatt
tatctcattggtttctacgaagaacgcgaattcgcattatacgtctcctccatctctaac
gaccttaaaattcctgttagatatttgagagaggacaagccacatggttctgctggtggt
ctttataacttcagagatatcatcatggaggaggatccgtcacatattttcttgctcaac
tgtgatgtttgctgtagttttcccctcccacaaatgctcgatgctcacaaaaaacatggt
ggcatgggaacaatattggttgtgaaggtttctccagagtcagccagtgaatttggagaa
ttggtagctgatccactcaccaatgaactcttgcattacacagaaaaacctgaaactttt
gttagtgatcttataaactgcggcgtttatatatttacaccagatatctttactgccatt
gagggtgtttcttctcagtggaaagacagagcaaacttaagacgtgtctccagctttgaa
gcaatgcagccagacacaaggagtcttaccaattatgtcagactggatcaagatatcctc
tcacctctagcagggaagaaacagttgtatatatatgaaaccatggatttttgggaacaa
atcaaaactccggggatgtcaataaaatgttcggccttgtatctttcgcaatttcgtcac
actgccccccacctattagcaaatggagatggtattaagaaagcctgcatcattggtgat
gtttatattcatccatcagcaaaagtgcatccgtctgcaaagattggtcctggcgtatca
atatctgcaaatgctcgtataggagctggtgcaaggctcataaattgtatagtgcttgat
gatgtagaaatcgaggagaatgctgttgtacttcatgcgattgttggatggaaatcctcc
attggacgatgggcccgtgtccagggtcgtggagattacaatgcaaaacttggagtcact
atacttggtgaatctgttgccgttgaggatgaggtagtggttattaacagtattgtcctt
cctcacaagatcctaaatgttggcgttcaagatgagatccttttatag

DBGET integrated database retrieval system