KEGG   Cicer arietinum (chickpea): 101508589Help
Entry
101508589         CDS       T02819                                 

Definition
(RefSeq) external alternative NAD(P)H-ubiquinone oxidoreductase B3, mitochondrial-like
  KO
K17871  NADH:ubiquinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
cam  Cicer arietinum (chickpea)
Brite
KEGG Orthology (KO) [BR:cam00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    101508589
Enzymes [BR:cam01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:ubiquinone reductase (non-electrogenic)
     101508589
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox EF-hand_1 EF-hand_5 EF-hand_8 EF-hand_6 NAD_binding_8 EF-hand_7 NAD_binding_7 DUF1858 DUF1002 ThiI p25-alpha
Motif
Other DBs
NCBI-GeneID: 101508589
NCBI-ProteinID: XP_004507222
UniProt: A0A1S2YN03
Position
Ca6
AA seq 575 aa AA seqDB search
MSWSSFYHTASRVFHEYPSWSKSVVVCTIISGGGLVAYNDARSAYSDCGDQIPKKKVVVL
GTGWAGTSFVKTMKDPSYDIHVVSPRNYFAFTPLLPSVTCGTVEARSVVEPIRNISRKSG
LNVQFSEAECYKIDPKNNKVYCRAGQDKKLDGIEEFSIDYDYLIIAMGGRSNTFNTPGVQ
ENAYFLKEIEDALRIRQKVINLFERASLPSISVEEKKKLLSFVVVGGGPTGVEFAAELHD
FVHEDLCKLYPSLINHVKITLLEAGDHILNMFDKRITEFAEKKFNRNGIDVKLGSMVVKV
GEKDISAKERGSGQVVTMPHGMVVWSTGIGVRPEILDFMKQLGQINRRALVTDEWLRVEG
CDNIYALGDCATINQRRVMEDIAVIFNKADKNNSGMLDLKEFKNVVGDIIERYPQVDIYL
KKNQMKDMATLLKKSQESSLTVDIEYFKDALSKVDSQMKNLPATAQVAAQQGAYLADCFN
RMELCEKYPEGPLRFRGIGRHRFRAFRYKHFGQFAPLGGEQTAAQLPGDWVSIGQSSQWL
WYSVYASKLVSWRTRALVISDWGRRFIFGRDSSQI
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgagttggtcttcattttatcacacagcctcgagggtttttcacgagtatccatcctgg
tccaaatctgttgttgtatgcactattatcagtggtggaggtctagtggcatacaatgat
gccagatcagcatatagtgattgtggtgatcaaatcccaaaaaagaaggtggtggtgctt
ggaactggttgggctggaactagttttgtaaaaaccatgaaagatccgtcttatgacatt
catgttgtttcaccacgtaactattttgcattcactcctttgttaccaagtgttacttgt
ggcacagtggaggcacgaagtgttgttgaaccaattcgaaatatcagcagaaagagtgga
ttaaatgttcaattcagtgaagctgaatgctataagatcgatccaaagaacaacaaagta
tactgccgtgctggtcaagacaaaaagcttgatggcatagaagaattttccattgattat
gattatttgataatagctatgggaggtcgttctaatacctttaacacacctggtgttcag
gagaatgcctatttcttgaaggaaattgaagatgctctaagaatccgccaaaaagtgatt
aacctttttgaaagagcaagcctcccttctatatcagtggaagagaagaaaaagcttctg
agttttgtagttgttggtggtggtccaactggtgtagagtttgctgcagagttacatgat
tttgtccatgaagatctatgtaaattatatccttctcttataaaccacgtcaagattact
ctcttggaggctggtgatcatatcttaaacatgtttgacaagagaataacagaatttgct
gaaaaaaagttcaacagaaatggaattgatgtgaagttaggatcaatggttgtaaaagtt
ggtgaaaaagatatctctgccaaagaaagaggaagtggtcaagttgttactatgcctcat
ggtatggttgtttggtcaactggtattggtgttcgtcctgaaatacttgatttcatgaaa
caacttggtcagattaatagacgtgcattggtcactgatgaatggctaagggtggaaggg
tgtgacaacatctatgctttaggtgattgtgcaactataaatcaacgaagagttatggaa
gatatagctgtgatatttaacaaggcagacaagaacaactcaggaatgttagatcttaaa
gaatttaaaaacgttgttggggacattattgagaggtatccacaagtggacatttattta
aagaaaaatcaaatgaaagacatggccactttgctaaaaaaatctcaagaaagctcattg
acagtggacattgaatacttcaaagatgctctttccaaagttgattcccagatgaaaaat
cttcctgcaacagctcaggttgctgctcaacaaggagcctatcttgcagactgtttcaat
cggatggagttgtgtgagaaatatccggaaggccctctaaggtttaggggaataggacgc
catcgttttcgtgcctttaggtacaagcattttggacaatttgctcctcttggtggagaa
caaactgctgctcagcttccaggagattgggtttctattggtcaaagtagtcaatggtta
tggtattcagtatatgcaagcaaactagttagctggagaacaagggctttggtgatatct
gactggggaaggagattcatatttggaagagactcaagtcaaatttga

DBGET integrated database retrieval system