KEGG   Cicer arietinum (chickpea): 101508671Help
Entry
101508671         CDS       T02819                                 

Definition
(RefSeq) probable pre-mRNA-splicing factor ATP-dependent RNA helicase
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
cam  Cicer arietinum (chickpea)
Pathway
cam03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:cam00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    101508671
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cam03041]
    101508671
Enzymes [BR:cam01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     101508671
Spliceosome [BR:cam03041]
 Complex C
  Other components
   Step II factors
    101508671
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OB_NTP_bind HA2 Helicase_C S1 DEAD AAA_22 AAA_19 AAA_30 T2SSE AAA Sigma54_activ_2 Flavi_DEAD PhoH ABC_tran AAA_16 AAA_14
Motif
Other DBs
NCBI-GeneID: 101508671
NCBI-ProteinID: XP_004499233
UniProt: A0A1S2Y4K2
Position
Ca4
AA seq 1203 aa AA seqDB search
MGAEIPQDGLKKKLEYLSLVSKVCTELESHTGTGDKVLAEFITELGHSSETVEEFDSKLK
LNGAEMPDYFVRTLLTIIHAILPPKPKKEKEIPKENAASKTKFKALAISDDRDRAKELRI
EIESEAREKQKQKEPLERYQRDRVEDDGSRDRDRRDRHKDRYDRDRDDKRDYRRKNDRDR
DRDRDRDKDRDRDMDRERDRDRDRDRYERRRRDEYEEYEGGGGREENGDEKGYRDRDSKR
RDGGSGEIELYMVYKGRVSRVMETGCFVQLDDFRGKEGLVHVSQIATRKIANAKEVVKRD
QEVYVKVISVSGSKLSLSMRDVDQHSGKDLLPLKKSSEEEAFRTNPQDSKDGLVARTGLS
GIRIVEEDDVGSSRRPLKRMSSPERWEAKQLIASGVLSVSEYPTYDDEGDGVMYQEEGAE
EELEIEMNEDEPAFLQGQSRYSMDMSPVKIFKNPEGSLGRAAALQSALIKERREVREQQQ
RTMLDSIPKDLNRPWEDPMPESGERHLAQELRGVGLSAYDMPEWKKDAYGKTITFGQRSK
LSIQEQRQSLPIYKLKKELIQAVHDNQVLVVIGETGSGKTTQVTQYLAEAGYTTRGKIGC
TQPRRVAAMSVAKRVAEEFGCRLGEEVGYAIRFEDCTGPDTVIKYMTDGMLLREILVDEN
LSQYSVIMLDEAHERTIHTDVLFGLLKQLVKRRPELRLIVTSATLDAEKFSGYFFNCNIF
TIPGRTFPVEILYTKQPESDYLDAALITVLQIHLTEPEGDILLFLTGQEEIDFACQSLYE
RMKGLGKNVPELIILPVYSALPSEMQSRIFDPAPPGKRKVVVATNIAEASLTIDGIFYVI
DPGFAKQNVYNPKQGLDSLVITPISQASAKQRAGRAGRTGPGKCYRLYTESAYRNEMSPT
SIPEIQRINLGMTTLSMKAMGINDLLSFDFMDPPSPQALISAMEQLYSLGALDEEGLLTK
LGRKMAEFPLDPPLSKMLLASVDLGCSDEILTIIAMIQTGNIFYRPREKQAQADQKRARF
FQPEGDHLTLLAVYESWKNKNFSGPWCFENFVQSRSLRRAQDVRKQLLTIMDKYKLDVVS
AGKNFTKIRKAITAGFFFHAARKDPQEGYRTLVENQPVYIHPSSALFQRQPDWVIYHELV
MTTKEYMREVTVIDPKWLVELAPRFFKVADPTKMSKRKRQERIEPLYDRYHEPNSWRLSK
RRA
NT seq 3612 nt NT seq  +upstreamnt  +downstreamnt
atgggtgctgaaattccacaagatggattgaagaagaaactcgagtacctatcactagta
tccaaagtatgcaccgagttagaatcccacaccggtaccggcgacaaggttctcgccgag
ttcattacagagttaggtcattcatctgaaaccgtcgaggaatttgactccaaactcaaa
ctaaacggcgccgaaatgcctgattactttgtccgtacactcctcaccattatccacgcc
attctccctccaaaacctaagaaggagaaagaaattccgaaagagaatgcggcgtcgaag
accaagtttaaggcgttggcgatttcggatgatagggatcgtgccaaggagctccggatt
gagattgaatccgaagcgagggaaaaacaaaagcaaaaggaaccattggagagatatcaa
agagatagggttgaagatgatggttctagagatagggatagaagagataggcacaaagat
aggtatgatagagatagagacgataaaagggattatagaaggaaaaatgatagagataga
gatagagatagagatagagacaaggatagagatagagatatggatagagaaagggatagg
gatagggatagggatcgatatgagaggcgaaggagagatgagtatgaagagtatgaaggt
ggtggtggaagggaggagaatggtgacgagaaaggttatagagatagagattcgaagagg
cgtgatggtggttctggtgaaattgagttgtatatggtttataaaggaagagtgtctagg
gtgatggaaactgggtgttttgttcagttggatgattttagagggaaggagggtttggtt
catgtttctcagattgctactaggaagattgcgaatgctaaagaggttgttaaaagggat
caagaggtttatgtcaaggtgatttcagtttctggttcgaagttgagtctttccatgagg
gatgttgatcagcatagcgggaaggatcttcttccgttgaagaagagttcggaggaggag
gcttttcggactaatccacaggattcaaaggatgggctggtggctaggacagggctttct
gggattaggattgtggaggaggatgatgttggatcttcgcgtaggccgctgaagagaatg
agttctcctgagagatgggaagcaaaacagttgattgcttcgggggttttgagtgtttcg
gagtatccgacttatgatgacgagggagatggagtgatgtaccaagaagaaggagctgag
gaagagcttgagattgagatgaatgaggatgaaccagccttcttgcaagggcagagcaga
tactcaatggatatgtctcctgttaagatctttaagaatccagaaggctctctgggtcgt
gctgctgcactacagtctgcgcttataaaggaacgcagggaagtaagagaacagcagcag
cgtaccatgcttgattcaatcccaaaggatctcaatcgtccttgggaagaccctatgcca
gagtcaggtgaaaggcatcttgcccaagagttgaggggtgttggcttatcggcctatgat
atgccagaatggaagaaggatgcctatgggaagaccattacttttgggcaaaggtcaaaa
ctttctattcaggaacaaaggcagagtttgccaatttacaagttaaaaaaagaattgatt
caggctgtccatgataatcaggttttggttgtgattggtgaaaccggttcgggtaagact
actcaggttacacaatatcttgctgaagcaggttacaccacaagaggtaaaattggatgt
actcaaccacgtagggtggctgcaatgtcagtggcaaagagagttgcagaagagtttgga
tgtagattaggagaggaagttggttatgccattcggtttgaggattgcactggacccgat
accgtaatcaagtacatgacagatggtatgcttcttagggaaatattggttgatgagaat
ctgtcacagtattctgttataatgcttgatgaagcccatgagagaactattcatactgat
gttctttttggattgctaaagcagctggtgaagcgtagacctgagttgcgattgattgtc
acatctgctactcttgatgctgaaaaattttcaggttacttctttaactgtaacatcttc
acaattcctgggagaacttttcctgtggagatactttatactaaacagccagaaagcgat
tacctggatgcagctttgatcactgtcctacagatccacttgacagaacctgaaggagac
attcttctcttcttaactggtcaggaagagattgattttgcttgccagtctctctatgag
agaatgaagggattaggtaagaatgtcccagaactgatcattttacctgtttatagtgcc
cttccaagtgaaatgcaatctaggatatttgatcctgctcctcctgggaaaaggaaagtg
gttgtggctactaacattgctgaggcttctttgactattgatgggatattttatgtcatt
gatccgggcttcgctaagcaaaatgtttataatccgaagcaaggtctcgattcgttggtg
ataactccaatatcacaagcgtcagccaaacaaagagctggacgtgcaggccgtactgga
cctggaaagtgttatcgcctctatacagagagtgcatataggaatgagatgtctcctact
tcaattccagagattcaaaggataaatcttggcatgactactcttagcatgaaagctatg
ggcataaatgatcttctttcgtttgattttatggatccaccatcaccccaagcacttatt
tctgccatggagcagctttacagtcttggagcattagatgaagaaggtcttctaaccaaa
ttggggaggaaaatggctgaatttcctttggatccaccactatccaagatgctgcttgcc
agtgtagaccttggttgcagtgacgagattttgaccataattgccatgatccaaactggc
aatattttttacaggcccagggaaaaacaagcccaagcagatcagaaaagggcaaggttt
ttccagccagaaggtgaccatcttacgttacttgctgtttacgagtcctggaaaaataaa
aacttttctggaccctggtgttttgagaactttgttcagtctcgatcgttgagaagagcc
caggatgttaggaaacaacttcttaccatcatggataagtacaaattggatgttgtcagt
gctggaaaaaacttcaccaagattaggaaggctatcactgcagggttcttttttcatgca
gctagaaaggacccccaggaaggttacagaacactagttgagaatcaacctgtatacatc
catccaagttcagctttgttccagagacagccagactgggtcatataccatgagcttgta
atgacaactaaggaatatatgcgtgaggtcactgtcatagaccctaaatggcttgttgag
ttggctccaagattcttcaaagtggcagatcctacaaagatgagcaaacggaagcgtcaa
gaacgcattgaaccactttatgatagataccatgagccaaattcatggcgtttgagtaaa
cgccgagcatga

DBGET integrated database retrieval system