KEGG   Cicer arietinum (chickpea): 101508897Help
Entry
101508897         CDS       T02819                                 

Definition
(RefSeq) external alternative NAD(P)H-ubiquinone oxidoreductase B2, mitochondrial-like
  KO
K17871  NADH:ubiquinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
cam  Cicer arietinum (chickpea)
Brite
KEGG Orthology (KO) [BR:cam00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    101508897
Enzymes [BR:cam01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:ubiquinone reductase (non-electrogenic)
     101508897
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox EF-hand_1 EF-hand_6 p25-alpha EF-hand_7 EF-hand_10 DAO EF-hand_5
Motif
Other DBs
NCBI-GeneID: 101508897
NCBI-ProteinID: XP_012568745
UniProt: A0A1S3DZ55
Position
Ca1
AA seq 577 aa AA seqDB search
MSTLTFFERLSKTFHDHRSHLKLVLLCSAVSGGGILAYGELAPSEAAVTDKKKVVVLGTG
WAATSFMKNLNNPRYEVQVVSPRNYFAFTPLLPSVTCGTVEARSIVEPVRNIFRKKKVNV
QFNEAECYKIDAENKKIYCRSKGNNNLNGKEEYEVDYDYLIIGVGATVNTFNTPGVVENC
HFLKEVEDAQKIRRTVIDCFERANLPDISEEEKKRILHFAIVGGGPTGVEFAAALHDFVK
DDLARLYPGIKDLVKITLLEAGGHLLSMFDKRITAFAEDKFQREGIDVKTGSMVVKVSEK
EISTKDLKNGGEIKTIPYGMAVWSTGIGTRPFIRDFLSQIGQASRRAVATDEWLRVEGCN
NVYALGDCATINQRKVMEDIAAIFKKADKSSSGTLTVKEFQEAMHDICERYPQVELYLKS
KQMRNIADLLSEAKGDVKKEPIELNIEELKTALSKVDSQMKFLPATAQVASQQGIYLAKC
FNRMEECEKNPEGPLRFRGEGRHRFKPFRYKHLGQFAPLGGEQTAAQLPGDWVSIGHSSQ
WLWYSVYASKQVSWRTRALVVTDWSRRFIFGRDSSRI
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgtccactctcactttcttcgagcgtctttctaaaactttccatgaccatcgctctcat
cttaagcttgtactcctctgctccgccgttagtggtggtggtatcttggcttacggtgag
ttggctccatcggaagcggcggttaccgataagaaaaaggtggtggtgctgggaactggt
tgggcggcaacaagtttcatgaagaatttgaacaatccgagatacgaggttcaggtggta
tcgcctcgtaattattttgcattcactcctctgttacctagcgtaacttgcggcaccgtg
gaagcgcgcagcattgttgaacccgttcgcaatatttttaggaagaaaaaggtgaacgtg
caattcaatgaagcagaatgttacaagattgatgcggaaaataagaaaatttattgtcga
tctaaaggaaacaataatttgaatgggaaagaagaatatgaagtggactatgactatcta
atcatcggcgtgggcgctactgtcaatacatttaacacaccaggagtggtggagaattgt
cactttttgaaggaagttgaagatgcccagaagattagaagaacagttattgactgtttt
gagagagcaaatttgcctgatataagtgaggaagaaaagaagagaattcttcattttgct
attgttggaggtggaccaactggagtggagtttgcagctgcacttcatgactttgtcaaa
gatgatttagcccgtttatatcctggaataaaagatttagtaaagattacacttctggaa
gctggaggtcatctcttgagcatgtttgacaaaaggataactgcttttgctgaagataag
tttcaaagagaagggattgatgtgaaaacaggatccatggttgtgaaggtatccgagaaa
gaaatttccaccaaagatctgaaaaatggaggagaaattaagaccattccatatggaatg
gctgtctggtcaaccggtattggcactcgtccatttattagagattttctgtcccagatt
ggtcaggctagcaggcgtgctgtagctactgatgaatggttgagagtggaaggatgtaac
aacgtgtatgctcttggtgattgcgctacgataaatcaacgaaaagtcatggaagatatt
gccgctatctttaagaaggccgacaaaagcagttcaggaacgcttacggtcaaagaattt
caagaggccatgcatgacatttgtgaacgataccctcaggttgagctgtatctgaagagt
aaacagatgcgcaacattgctgatttattgagtgaagccaagggagatgttaaaaaagaa
ccaattgaactgaatatcgaagaactcaaaacggccctttccaaagtggattctcagatg
aaatttctacctgctacagcacaggttgcatctcagcaaggaatttacctagccaaatgt
tttaaccggatggaagagtgtgagaaaaatccagagggtcctctcaggttcaggggagaa
ggtcgtcatcggttcaaaccctttaggtacaagcacttaggtcagttcgctcctttggga
ggagagcagacagctgcccagcttcctggggattgggtttcaattggtcacagcagtcaa
tggttgtggtattctgtctatgcaagcaaacaagtaagctggcgtacaagggcactagta
gtgacagactggtcaagacgttttattttcgggagagattcaagccgcatctga

DBGET integrated database retrieval system