KEGG   Cicer arietinum (chickpea): 101509598Help
Entry
101509598         CDS       T02819                                 

Definition
(RefSeq) probable choline kinase 1
  KO
K14156  choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
cam  Cicer arietinum (chickpea)
Pathway
cam00564  Glycerophospholipid metabolism
cam01100  Metabolic pathways
Module
cam_M00092  Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:cam00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    101509598
Enzymes [BR:cam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     101509598
    2.7.1.82  ethanolamine kinase
     101509598
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Choline_kinase APH EcKinase UPF0154 Haspin_kinase Arylsulfotran_N
Motif
Other DBs
NCBI-GeneID: 101509598
NCBI-ProteinID: XP_004496428
UniProt: A0A1S2Y063
Position
Ca4
AA seq 364 aa AA seqDB search
MAIKTIELLKGCESQEEIMEVIASVASDLGDVIDDVNTLQVIPLKGAMTNEVFQINWPTE
NGADLRKVLVRLYGEGVEVFFNRDEEIRTFECISKHGQGPRLLARFTTGRVEEFIHARTL
SASDLRDLEISALIAFKMREFHKLHMPGTKKAHIWQRMRKWLGEAKSLCSPKETKKFGLD
NLDEEINILEKESCEGYQEIGFCHNDLQYGNIMMDEEARSITLIDYEYASYNPIAYDLAN
HFCEMAADYHTDTPHVLDYSKYPELEERQRFIRAYLSSEGKKPSNAKVNQLVNAVEKYTL
ANHLFWGLWGLISSYVNKIDFDYKEYARQRFQQYWLRKPTLLDSPTIVSQNETVNGSLPL
ASFV
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggccataaagacaattgaattattgaaagggtgtgaatcccaagaagaaataatggaa
gtgattgcttctgtggcttctgatttgggtgatgtaatcgatgatgtgaacaccttgcaa
gtgattccattgaaaggtgcaatgaccaatgaagtttttcagataaattggcctacagaa
aatggtgctgatctcagaaaggttttggttcgattatatggagaaggtgttgaagttttc
ttcaatagggatgaagaaattcgaacctttgagtgtatctcaaagcatggtcaaggtcca
cgccttcttgctcgatttacaactggtcgtgttgaggagtttattcatgccagaactctc
tcggcttccgatctccgtgacctcgaaatatctgctttgatagcatttaagatgagagaa
ttccataagcttcatatgcctggtacaaagaaggctcatatttggcagagaatgaggaaa
tggcttggtgaagccaaaagtttgtgctccccaaaggaaacaaaaaaatttgggttggac
aatctagatgaggaaataaatatcttggagaaggagtcatgtgaaggatatcaagagatt
ggtttttgtcacaacgacttgcaatatggtaacattatgatggatgaagaagctagatca
atcactctaattgactacgaatatgcgagttacaatcctatcgcgtatgacctagcaaat
catttctgtgaaatggcagcagattaccatactgatacacctcatgtacttgactacagc
aaatatcctgaactagaggagcgtcaaaggtttattcgcgcctatctgagttctgaaggc
aagaaacccagcaatgctaaggtgaaccagttggtgaatgctgtagaaaaatacactctt
gcaaaccatctattttggggcttatggggacttatttcgagctatgtgaataaaattgac
tttgattacaaagaatatgcaagacaaaggtttcagcagtactggttaaggaaacctact
ttattggactcaccaaccattgtttcacaaaatgaaactgtgaatggttcactgccacta
gcatcctttgtgtga

DBGET integrated database retrieval system