KEGG   Cicer arietinum (chickpea): 101510463Help
Entry
101510463         CDS       T02819                                 

Definition
(RefSeq) phosphatidylinositol-3-phosphatase myotubularin-1
  KO
K18081  myotubularin-related protein 1/2 [EC:3.1.3.64 3.1.3.95]
Organism
cam  Cicer arietinum (chickpea)
Pathway
cam00562  Inositol phosphate metabolism
cam01100  Metabolic pathways
cam04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:cam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101510463
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    101510463
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cam01009]
    101510463
Enzymes [BR:cam01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     101510463
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     101510463
Protein phosphatases and associated proteins [BR:cam01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    101510463
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related GRAM Y_phosphatase BBL5 bPH_3
Motif
Other DBs
NCBI-GeneID: 101510463
NCBI-ProteinID: XP_004496171
UniProt: A0A1S2XXP7
Position
Ca4
AA seq 844 aa AA seqDB search
MDVPKPRPTPTTSLRDASDSSTGSWDAIEWTKIEPIPRFASHANLDFLLEEEQVFAEGHG
VVLVNTDDAGVLIVTNFRVIFLSEGTRKVIALGTIPLATIEKFNKIAVKVQSNTRQLDKT
PTQRLLQVIGKDMRIIVFGFRPRTKQRRAIYDALLKCTKPTILWDLYAFTSGPSRFKNTS
PLVRLLDEYLRLIGKDTHHASMDMIESGSFTLSNDLWRISSVNSSYTMCQSYPFALVVPK
TISDDEVLQACKFRARCRLPVISWCHPDTGAVLARSAQPLVGLMMNIRSITDEKLVAALC
SNLDGSRRKLYIADARPRKNAIANGALGGGSESSSNYFQSEIVFFGIDNIHGMRESFVRL
REYMDNHGRTSSDGMSSFLRHGGGSIWGGGNLSSMSASVTTLGDSGWLSHVQNVLAGGAW
IASRVAMEKASVLVHCSDGWDRTSQLISLANLLLDPYYRTFRGFQALVEKDWLAFGHPFS
DRVGTPSVSGSGNVSFELSRQSSTGIASPPMRQSSGTIPPQPSVSSQAHNSNNHSPIFLQ
WVDCVSQLLRMYPFAFEFSAAFLVDFLDCMFSSRFGNFFFNSEKERLQCSVFETCGCLWA
YLADMRASEGGSHAHCNPFYDPLKYSSPLLPPAAALAPTLWPQFHLRWACPEEAQSGEVE
AQCRKIILKNFEIQKAKEVAERKAQETTSAMELLNAELRREKVLNISATNKAKRITKENT
DIKRAIQSIGCKIHFSSSGDCIVDIENNPADAVPNLRCSSRQGSSTAVINDKTDLSVSVT
EDDDDDGNNVIGRICETLCPFRTGDGGCRWPNGGCAQLGSQFVGFKANFDAFDRLSIDDS
YFKP
NT seq 2535 nt NT seq  +upstreamnt  +downstreamnt
atggacgtgccgaaaccccgccccacaccaactacgtctctaagagacgcctctgactcc
tctactggtagctgggacgccatcgaatggaccaaaattgagccaattccgcgtttcgcc
tctcacgcgaatctcgatttcttgctcgaggaagagcaagttttcgccgaaggacacggt
gttgttcttgttaatacagatgatgcaggcgtgttgatcgtaacaaactttcgtgtaata
tttctgagtgagggaactagaaaagttattgctcttggaacaataccactagcaaccatt
gagaagtttaacaagatagctgtaaaggttcagtcaaatactcgtcaattagacaagaca
ccaacacaaagactgctccaggtgattggaaaagatatgagaattatagtctttggtttt
aggcctcgtacaaaacagagacgtgcgatatatgatgcactacttaagtgtacgaagcca
acaatattatgggatctttatgcttttacatctgggccttccaggtttaagaacacttct
cctttggtgcgcttattggatgagtatttgcgacttattggcaaagatactcaccacgct
tcaatggacatgattgaaagtgggtctttcaccttgtcaaatgacttatggagaataagt
agtgtgaattccagttatacaatgtgccagagttatccatttgctttggttgttccaaag
accattagtgatgatgaagtgctccaggcttgcaaattccgtgctagatgccggctgcct
gtaatttcatggtgtcatcctgatactggcgcagttcttgcacgttccgcccaaccttta
gttggtctcatgatgaatataaggagcatcacggatgaaaaacttgtggctgcactttgc
agcaaccttgatggctcaaggagaaagctatatattgctgatgcgagaccaaggaaaaat
gcaatagctaatggagccttgggaggtggttcagaatcatcatcaaactattttcaatct
gagatagtcttttttggaatagacaacatccatggaatgagagagagctttgttcggctt
cgagagtacatggacaatcatggcagaacatcatcagatggaatgtcctcatttttgaga
catggtggtgggtcgatatggggtggtggcaatttaagtagtatgtctgcttcggttaca
acccttggggacagtggatggttatcgcatgttcagaatgtcttggctggtggagcttgg
attgcttctcgtgttgctatggaaaaggcttctgttcttgtacattgcagtgatggatgg
gataggacaagccagttaatttcactcgctaatttgttgcttgatccgtattatcggaca
ttcagagggtttcaggcacttgttgaaaaagactggttagcatttggtcatccattttct
gatcgtgtgggaacaccatctgtctctggaagtggcaacgtatctttcgagttatctagg
cagtcttcaactggcatcgcatcgccacccatgcgccagtcatcaggaacaatcccacct
caaccttcagtttcatctcaggcgcataactcaaacaaccactctcccatttttttgcag
tgggttgattgtgtgtcacaactgctgcggatgtatccttttgcttttgaattttctgcg
gctttcctggtggacttcttagactgcatgttttcttctcgctttggaaacttcttcttt
aatagtgagaaggagaggctgcagtgcagtgtgtttgaaacttgtggatgtttgtgggca
tacttggctgatatgcgggcatcagaaggaggttctcatgcgcattgtaatcccttttat
gatccactgaagtatagcagtcctcttctgcccccagcagcagcgttagccccaacttta
tggccccaattccaccttcgttgggcctgcccagaagaagcacaaagtggggaggttgaa
gcacaatgtaggaagataattctgaaaaactttgagatacagaaggctaaagaagtggca
gaaaggaaagctcaagaaactacaagtgccatggaattgttgaatgctgaattgcgacgt
gagaaggtgttaaacatctcagctacgaacaaagccaagaggataaccaaagagaataca
gacataaagcgtgcaattcagtcaattgggtgcaagattcacttttctagtagtggtgat
tgcattgttgacattgaaaacaacccagcggatgcagttccaaacttgcgttgttcctct
aggcaagggtcaagtactgctgtgattaatgacaaaacggatctatctgtttctgtaaca
gaagacgacgacgatgatggaaacaatgttattggtcgaatatgtgaaactctatgccca
tttcgcactggagatggaggctgcagatggccaaatggtggttgtgctcaactaggtagt
cagtttgttgggtttaaggcaaatttcgatgcatttgaccgactctcgattgatgacagt
tatttcaagccttag

DBGET integrated database retrieval system