KEGG   Cicer arietinum (chickpea): 101510708Help
Entry
101510708         CDS       T02819                                 

Definition
(RefSeq) glycine--tRNA ligase 1, mitochondrial-like
  KO
K01880  glycyl-tRNA synthetase [EC:6.1.1.14]
Organism
cam  Cicer arietinum (chickpea)
Pathway
cam00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:cam00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    101510708
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cam01007]
    101510708
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cam03016]
    101510708
   03029 Mitochondrial biogenesis [BR:cam03029]
    101510708
Enzymes [BR:cam01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     101510708
Amino acid related enzymes [BR:cam01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   101510708
Transfer RNA biogenesis [BR:cam03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    101510708
Mitochondrial biogenesis [BR:cam03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    101510708
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HGTP_anticodon tRNA-synt_2b WHEP-TRS WIYLD
Motif
Other DBs
NCBI-GeneID: 101510708
NCBI-ProteinID: XP_004499600
UniProt: A0A1S2Y5E7
Position
Ca5
AA seq 720 aa AA seqDB search
MLFYLSTLITVATKASSRISSFLPQTRFISSLMAPTEETLRKALEGKLSAVENQANIVRE
LKAKSALKPDIDAAVQALNALKLEKSDIEKSLQSLLSGTGSDSREAFRQSVVNTLERRLF
YIPSFKIYRGVAGLYDYGPPGCAVKSNVLSFWRQHFVLEENMLEVDCPCVTPEVVLKASG
HVDKFTDLMVKDEKTGTCYRADHLLKDYCNEKLQKDLTLSSDKAAEIKHVLAMLDDFSSQ
ELGAKIKEYGITAPETKNPLSDPYPFNLMFQTSIGPSGLAPGFMRPETAQGIFVNFKDLY
YYNGNKLPFAAAQIGQAFRNEISPRQGLLRVREFTLAEIEHFVDPEDKSHPKYAEVADLE
FLMFPREEQVSGQSAKKIRLGEAVSKGIVNNETLGYFIGRVYLFLTRLGIDKDRLRFRQH
LANEMAHYAADCWDAEIECSYGWIECVGIADRSAYDLRAHSEKSGVPLVAHEKYSEPKEV
EKLVITPIKKELGLAFKGNQKMVVEALEAMHEKEALDMKAALESKGEVGFEVCTLGKTVT
IKKSMVTIHKETKKEHQRVFTPSVIEPSFGIGRIIYCLFEHTFYTRASKAGDEQLNVFRF
PSLVAPIKCTVFPLVQNQKYEEVAKLISKSLTAAGISHKVDITGTSIGKRYARTDELGVP
FAVTVDSTTSVTIRERDSKDQVRVDVEKAATVIREVSEGQRTWEDVWSTFPHHSSTATDE
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgcttttttatttatcaacactgataactgtagccaccaaagcttcatcaagaatatct
tcatttctaccacaaacacgcttcatttcttctctcatggctcccaccgaagaaactctc
cgtaaagccctagaaggtaaactctccgccgtcgaaaaccaagccaacatcgttcgtgaa
ctcaaagcaaaatcagctcttaaacctgatatcgatgctgctgttcaagctttaaatgcg
cttaaactcgagaaatctgacatcgagaaatcacttcaatcgcttctctcgggtactggt
tctgattcccgtgaagcgtttcgtcaatcagttgttaacactcttgaacgccgtttattt
tacattccttcattcaaaatttatcgtggtgttgccggtctttatgattatggtcctcct
ggttgcgccgttaaatctaacgtcctctccttttggcgtcagcattttgttttggaggaa
aacatgcttgaggttgattgtccctgtgttacaccggaggttgttctgaaggcttctggt
cacgtggataaattcacagatctcatggtgaaggacgagaaaaccggcacgtgttaccgt
gctgatcatttgctcaaggactattgcaatgagaagcttcaaaaagatctcactttgtca
tcagataaagctgcagagatcaaacacgtgcttgctatgctggatgatttctcatctcaa
gagcttggtgctaagattaaggagtatggtatcactgctcctgaaaccaaaaatcccctg
tcagatccttaccctttcaatttgatgtttcaaacttctattggtccctcgggcttagca
cctgggtttatgcgtccggaaactgcacagggcatatttgttaatttcaaggacttgtac
tattacaatggaaacaagttaccctttgctgctgcacaaattggacaggcatttagaaat
gagatatctccccgtcaaggccttctcagagtccgggaattcaccttggcagaaattgag
cactttgttgatcccgaagacaagtctcatcctaagtatgccgaagttgctgacttggag
tttctcatgttcccaagggaagaacaggtgtctggtcagtctgcaaagaaaatccgtctc
ggtgaagctgtttcaaagggtattgtcaataatgagactcttggttatttcattgggaga
gtatatctcttcttgacgcgtctcggtattgacaaagaccgcttgagatttaggcagcat
cttgccaatgagatggcccattatgctgctgactgttgggatgctgagattgagtgttcc
tatggttggatcgagtgtgttggcatcgccgatagatctgcatatgatttgcgtgctcac
tcggagaaaagtggtgttccactggtggctcatgaaaagtattcagaacctaaggaagtg
gagaaattggttataactcccataaagaaagaattgggcttggcattcaaaggtaatcag
aagatggtggttgaagcacttgaggcaatgcacgagaaagaagccttggatatgaaggct
gcactggaatcaaaaggtgaggttgggtttgaagtgtgtacgcttgggaaaactgtaact
attaagaagagcatggtgaccattcacaaggagacaaagaaagagcatcagcgtgttttt
acaccgtctgtgattgaaccatcctttgggattggacggataatatattgcctatttgag
cacactttctatacgagggcaagtaaagctggggatgaacagttaaatgtatttcgcttt
ccttctcttgtggctcctattaagtgcacagttttccctctggttcaaaaccagaagtat
gaagaggttgccaaattaatttccaagtctttgactgctgctggaatttcccataaggtt
gacattacaggtacgtcaataggaaaacggtatgcaagaacagatgaacttggtgtgcct
tttgctgtcactgtggattcaacaacgtcagtgactattcgggagagggacagcaaggat
caagtgcgtgttgatgtggaaaaagctgcaactgttattagggaggtatccgaaggccag
aggacatgggaagacgtgtggtctactttccctcaccactcgtctaccgctacagatgaa
tag

DBGET integrated database retrieval system