KEGG   Cicer arietinum (chickpea): 101510753
Entry
101510753         CDS       T02819                                 

Definition
(RefSeq) phenolic glucoside malonyltransferase 1-like
  KO
K13264  isoflavone 7-O-glucoside-6''-O-malonyltransferase [EC:2.3.1.115]
Organism
cam  Cicer arietinum (chickpea)
Pathway
cam00943  Isoflavonoid biosynthesis
cam00944  Flavone and flavonol biosynthesis
Brite
KEGG Orthology (KO) [BR:cam00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00944 Flavone and flavonol biosynthesis
    101510753
   00943 Isoflavonoid biosynthesis
    101510753
Enzymes [BR:cam01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.115  isoflavone-7-O-beta-glucoside 6''-O-malonyltransferase
     101510753
SSDB
Motif
Pfam: Transferase Pro_isomerase AATase
Other DBs
NCBI-GeneID: 101510753
NCBI-ProteinID: XP_004489466
UniProt: A0A1S2XHK1
Position
Ca2
AA seq 455 aa
MSQSPTSLKVHHVLAIAPTNETSPTTFPFTFFDALWVRLPPVERLFFYEIPNLSTTFFDS
ILPNLKHSLELTLQHFIFLVGNIIWPQDSPHPIINYVPSDSISFIVAESNENFNHLCSNF
CEVEKKQPFIPSLKISHEKASIIALQVTFFPNHGFCIGITTHHAAIDGKSSTLFMKAWSY
FCSNLEKKTPSLSLPQNLTPSFDRSIINDPLGIKEIYSKSWMSYGGETNNRSLKVWETIS
GAKGEVVKGFFELSPLHIQKLKKYAQSKLENKVKLSSFSVTCAYLLSCAVKVEKPNTNKV
GFVFSVDCRTRLDPPINTNYFGNCIVSKLVVSKTETLLNDDGFISALEGIIDVLKGLESG
VLNGVESWMSNIQSILSETNGKLFSIAGSPRFEVYAFDFGWGRPKIVDVTSIDKTGAFSL
SEHKNNDGGIEIGLALNKEQMKNFTQLFVEGLESL
NT seq 1368 nt   +upstreamnt  +downstreamnt
atgagtcaatctccaacatctctcaaagttcatcatgttcttgctatagcaccaacaaat
gaaacctcaccaaccacttttccattcactttctttgatgcactttgggtaagacttcca
ccggttgaacgtctcttcttctatgaaattcctaatttatcaactactttctttgattca
attcttccaaatctcaaacactctcttgaactcacactccaacactttatctttcttgtt
ggtaacatcatttggccacaagattcaccacaccctattattaattatgtccctagtgat
tctatctctttcattgtagccgaatccaatgaaaatttcaatcatttatgttctaacttt
tgtgaagttgaaaaaaaacaaccctttatcccaagtttgaaaatttctcatgaaaaagca
tcaattattgcattacaagtcactttttttccaaaccatggattttgtattggtataacc
acacaccatgcagctattgatggaaaatcttcaactttgtttatgaaagcatggtcttat
ttttgttccaaccttgaaaaaaaaacaccctctttgtctttacctcaaaacctaacacct
tcttttgatagatccattataaatgaccctttagggataaaagaaatttattcaaaaagt
tggatgagttatggtggagaaacaaataatagaagcttgaaggtttgggaaacaattagt
ggagcaaaaggtgaagtagtcaaaggtttttttgaattgtcacctttgcatattcaaaag
cttaaaaaatatgcacaatccaagcttgaaaataaggtaaagttatcaagtttttcggtt
acttgtgcttatttgttgtcatgtgcggttaaagttgagaaaccaaataccaataaggta
ggttttgtttttagtgtggattgtagaactcgtttggatccaccaattaatacaaattac
tttggtaattgtattgtgtcaaaattggttgtgtctaaaaccgaaacattgttgaatgat
gatggatttattagtgctcttgaaggaataattgatgttttgaaaggtttggaaagtgga
gtgttaaatggtgttgagagttggatgtcaaacatacaatctatattaagtgaaactaat
ggtaagttgttttcaattgcggggtcccctagatttgaagtttatgcttttgattttgga
tggggtagacctaaaatagttgatgttacttctattgacaaaacgggtgctttttctctt
tcggagcataaaaataatgatggaggaattgagattggattggctttgaacaaagagcaa
atgaagaatttcactcaactttttgttgaaggacttgaatccttgtaa

DBGET integrated database retrieval system