KEGG   Cicer arietinum (chickpea): 101512523
Entry
101512523         CDS       T02819                                 

Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
cam  Cicer arietinum (chickpea)
Pathway
cam00100  Steroid biosynthesis
cam01100  Metabolic pathways
cam01110  Biosynthesis of secondary metabolites
Module
cam_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:cam00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    101512523
Enzymes [BR:cam01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     101512523
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 101512523
NCBI-ProteinID: XP_004497600
UniProt: A0A1S2Y0Y0
Position
Ca4
AA seq 369 aa
MDLGFLIHALIPSSNSVALLAGFFTYLAIVGSILPGKLVPGVVLPDGTRLHYRCNGLVSL
ILLVGLLWISAKMEFVSLTAIADRGLELLSTTFIFSFLVTLVLYFSGCKSQSKGSSLKPH
ISGNLIHDWWFGIQLNPQFMSIDLKFFFVRAGMMGWLLINLSVLAKSIQDGTLSKSMILF
QLFCALYILDYFVHEEYMTSTWDIIAERLGFMLVFGDLVWIPFTFSIQGWWLLRNKVELT
TASIVANCFVFLIGYKVFRGANKQKHDFKKNPKAPIWGKSPKVIGGKLLASGYWGVARHC
NYLGDLLLALSFSLPCGISSPVPYFYPIYLLILLIWRERRDEARCAEKYKEIWIEYRKLV
PWRILPYVY
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggatctgggttttctcattcacgctctaattccatcttcgaactctgtcgcattactc
gctggatttttcacttacttggccattgttggatccattctccctggaaaacttgttcct
ggtgttgttcttcctgatggaactcgtcttcactatcgatgcaatggtctagtttcgctt
attctgttggttggacttctttggatcagtgctaagatggaatttgtatctctaactgct
atagcagatagaggacttgagttgctgtctacaacttttatcttcagttttcttgtgacc
ttggtactctatttttccggttgcaagtcacagagtaaaggttcatcgctaaaacctcat
atcagtggaaacctgatacacgattggtggtttggaatacaattaaatcctcaattcatg
agtattgacctcaaatttttctttgttagagctggaatgatggggtggctactcatcaat
ctttcagttcttgctaagagcattcaagatggtactttgagcaagtcaatgattctcttc
cagctattctgtgcgctatacatcctggactactttgtacacgaagagtacatgacatcc
acatgggatataattgcagagagactaggattcatgttggtctttggagatttagtgtgg
attccttttacttttagcattcagggctggtggctcttgaggaacaaggtggagttaaca
acggcttctattgtagctaattgctttgtcttccttattggatacaaggtatttcgagga
gcaaacaagcaaaaacatgatttcaagaagaatccaaaggctcctatatggggcaagtct
ccaaaagtcattggaggcaagctacttgcttctggttattggggtgttgctagacactgt
aattacctaggggacttgctgcttgctctctctttcagcttaccttgtggcataagttca
ccagttccatacttctatccaatttatcttctcattctgttaatctggagagagagaagg
gacgaagctcgttgcgcagagaagtacaaagagatatggatagagtataggaaactcgtt
ccatggagaatattgccttatgtttattag

DBGET integrated database retrieval system