KEGG   Cicer arietinum (chickpea): 101514431Help
Entry
101514431         CDS       T02819                                 

Definition
(RefSeq) vestitone reductase
  KO
K13265  vestitone reductase [EC:1.1.1.348]
Organism
cam  Cicer arietinum (chickpea)
Pathway
cam00943  Isoflavonoid biosynthesis
cam01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cam00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00943 Isoflavonoid biosynthesis
    101514431
Enzymes [BR:cam01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.348  (3R)-2'-hydroxyisoflavanone reductase
     101514431
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Epimerase 3Beta_HSD NAD_binding_4 GDP_Man_Dehyd NAD_binding_10 NmrA KR Polysacc_synt_2 RmlD_sub_bind adh_short
Motif
Other DBs
NCBI-GeneID: 101514431
NCBI-ProteinID: XP_004492614
UniProt: A0A1S2XPQ3
Position
Ca3
AA seq 326 aa AA seqDB search
MAEGKGRVCVTGGTGFLGSWIIKRLLEDGYSVNTTVRADPERKRDLSFLTNLPNASERLQ
FFNADLSNPESFSTAIEGCVGIFHTASPIDFAVSEPEEVVTKRTVDGALGILKACVHSKT
VKRVIYTSSGSAVSFTGKDKQVLDESDWSDVDLFRTVKPFGWSYGVSKTLAEKAVLQFGE
QHGLDVVTLVLPFIVGRFICPKLPDSIEKALVLVLGKKEQIGVTRFHMVHVDDVARAHIY
LLENPVEGGRYNCSPFIVSIEEMSQLLSAKYPEFQILTVDELKEIKGARLPHLNSKKLVD
AGFEFKYSVDDMFDDAIQCCKEKNYL
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggctgagggaaaaggaagagtttgtgtaactggagggacaggttttcttggttcatgg
attatcaaaagactacttgaagatggttactctgttaataccactgttagagctgatcca
gaacgtaagagagaccttagcttcctcacaaatcttcctaatgcatctgaaagactacaa
tttttcaacgccgatctaagcaatccagaaagtttttccacagcaattgaaggttgtgtt
gggatattccacactgcatctccaattgattttgcagttagtgaacctgaagaagttgtg
acaaaaagaacagttgatggagcattaggcattttaaaagcatgtgttcattcaaagaca
gtaaaaagagttatatacacttcaagtggctctgctgtttcattcactggaaaagacaaa
caagtcttggatgagagtgattggagtgatgttgatttgtttagaactgtcaaaccattt
ggttggtcttatggagtttcaaagactttggcagaaaaagcagtgcttcaatttggtgaa
caacatggtcttgatgttgtcactttggttcttccttttattgttggacgtttcatttgt
cctaagcttcctgattctattgagaaagctcttgttttggtattagggaaaaaagaacaa
attggtgtgacacgtttccacatggtacatgtggatgatgtagctagagcacacatatat
ctacttgagaatcctgttgaaggaggaagatataattgttcaccattcattgtatctatt
gaagagatgtctcaacttctttcagctaaatatccagaatttcaaattctaacagtagat
gagttgaaggaaattaaaggtgcaaggttaccacatttaaactcaaagaagctagtggac
gctggttttgaatttaagtatagtgttgatgatatgtttgacgatgcaattcaatgctgc
aaggaaaaaaactatctctag

DBGET integrated database retrieval system