KEGG   Citrobacter amalonaticus Y19: F384_00445Help
Entry
F384_00445        CDS       T03934                                 

Gene name
murD
Definition
(GenBank) UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
cama  Citrobacter amalonaticus Y19
Pathway
cama00471  D-Glutamine and D-glutamate metabolism
cama00550  Peptidoglycan biosynthesis
cama01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cama00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    F384_00445 (murD)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    F384_00445 (murD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cama01011]
    F384_00445 (murD)
Enzymes [BR:cama01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     F384_00445 (murD)
Peptidoglycan biosynthesis and degradation proteins [BR:cama01011]
 Precursor biosynthesis
  Amino acid ligase
   F384_00445 (murD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: AKE57718
UniProt: A0A0F6RDV5
Position
101670..102986
Genome map
AA seq 438 aa AA seqDB search
MADYQGKNVVIIGLGLTGLSCVDFFLARGVTPRVMDTRATPPGLDKLPEAVERHVGSLND
DWLLAADLIVASPGIALAHPSLSAAADAGVEIVGDIELFCREAQAPIVAITGSNGKSTVT
TLVGEMAKAAGVNVGVGGNIGLPALMLLDAERELYVLELSSFQLETTFSLQAAAATILNV
TEDHMDRYPFGLQQYRAAKLRVYENAKVCVVNADDALTMPIRGADERCVSFGVNMGDYHL
NRQQGETWLRVKGEKVLNVKEMKLSGQHNYTNALAALALADAVGLPRASSLKALTTFTGL
AHRFQLALEHNGVRWINDSKATNVGSTEAALNGLHVDGTLHLLLGGDGKSADFSSLSRYL
EGDRVRLYCFGRDGAQLAALRPEIAEQTETMEEAMRLLAPRLQSGDMVLLSPACASLDQF
KNFEQRGDVFTRLAKELG
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggctgattaccagggtaaaaacgtcgtcattatcggtctggggttaaccggactctct
tgcgtggactttttcctcgcccgcggcgtaacccctcgtgtgatggatacccgtgcgaca
ccgccgggactggataagttaccggaagcggtagagcgccatgtcggcagtctgaacgat
gactggttgctggcagcggatctaattgtggcaagccctggtatcgccctcgcgcatccg
tcactgagcgctgcggctgatgcgggcgttgagatcgtgggtgatatcgaactgttctgc
cgtgaagcgcaggcgccgattgtcgcgattaccggctcgaacgggaaaagcaccgtcacg
acgctggtgggtgaaatggcgaaagcggccggtgtgaacgtcggcgttggcggcaacatt
ggtttgcccgcgctgatgctgctggatgcagaacgtgaactgtatgtccttgaactctcc
agcttccaactggaaaccacgttcagcctgcaggcagcggctgccactattctgaacgtc
accgaagaccatatggacaggtatccatttggtttacaacagtatcgtgctgcaaaactg
cgcgtttacgagaatgcaaaggtctgcgtggtcaatgccgatgatgcgttgacgatgccg
attcgtggtgccgatgagcgctgtgtgagctttggcgtcaacatgggtgattatcacctt
aaccgtcaacagggcgaaacctggctgcgggtgaagggtgagaaagtgttgaatgtgaaa
gagatgaagctttccggtcagcataactacaccaacgccctggcggcgctggcgctggca
gatgcggtaggtttaccgcgcgccagcagcctgaaagcgctgacgacgtttaccggtctg
gcgcatcgtttccagttagcgctggagcataacggtgtgcgctggattaacgactcgaag
gcgaccaacgtcggcagcactgaagccgcgctgaacggcctgcacgttgacggtacgctg
catctgctgctgggcggcgatggtaaatcggcggacttctcttcgctgagtcgctatctg
gaaggcgatcgcgtgcgcttgtactgctttggtcgcgatggtgcgcaactggcggcgctg
cgtccggaaattgcggagcaaaccgaaacaatggaagaggcgatgcgtctgctggcgccg
cgtctgcagtcgggcgatatggtgctgctgtctccggcctgcgccagcctcgatcagttt
aagaattttgagcaacggggcgatgtctttacccgtctggcgaaggagttgggttga

DBGET integrated database retrieval system