KEGG   Citrobacter amalonaticus Y19: F384_00545Help
Entry
F384_00545        CDS       T03934                                 

Definition
(GenBank) N-acetyl-anhydromuranmyl-L-alanine amidase
  KO
K03806  N-acetyl-anhydromuramoyl-L-alanine amidase [EC:3.5.1.28]
Organism
cama  Citrobacter amalonaticus Y19
Brite
KEGG Orthology (KO) [BR:cama00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cama01011]
    F384_00545
Enzymes [BR:cama01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.28  N-acetylmuramoyl-L-alanine amidase
     F384_00545
Peptidoglycan biosynthesis and degradation proteins [BR:cama01011]
 Peptidoglycan biosynthesis and degradation
  Amidase
   F384_00545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase_2
Motif
Other DBs
NCBI-ProteinID: AKE57738
UniProt: A0A0F6RDW3
Position
123239..123802
Genome map
AA seq 187 aa AA seqDB search
MLLDKGWLAEARRVPSPHYDCRPDDEVPSLLVVHNISLPPGEFGGPWIDALFTGTIDPNA
HPFFADIAHLRVSAHCLIRRDGEIVQYVPFDKRAWHAGVSSYHGRERCNDFSIGIELEGT
DTLAYTDAQYQQLAAVTRVLIKIYPAVADNITGHCDIAPERKTDPGPAFDWARFRALVTA
SSDKEMT
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgttgttagacaagggctggctggcagaagcgcgtcgcgttccttctccgcattacgat
tgccgcccggatgatgaagtcccttctttgctggtggtgcacaatatcagcctgccgccc
ggcgaatttggcggtccgtggattgacgcactattcaccggaacgattgatcccaacgcc
catcctttttttgccgacattgcgcaccttcgcgtttccgcccattgtctgattcgccgc
gatggcgaaatcgttcagtatgttcctttcgataagcgtgcgtggcatgccggtgtgtcg
agctatcatgggcgtgaacgctgcaatgatttttcgattggcattgagctggaagggacc
gatacgctggcctacaccgatgctcagtaccaacaactggcagccgtcacgcgtgttttg
ataaagatttacccggccgttgccgacaacataaccgggcactgcgatattgcgcctgag
cgtaagaccgatcccggtccggcttttgactgggcaaggtttcgcgcactggtcaccgcc
tcgtcagataaggagatgacatga

DBGET integrated database retrieval system