KEGG   Citrobacter amalonaticus Y19: F384_02775Help
Entry
F384_02775        CDS       T03934                                 

Definition
(GenBank) hydrolase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
cama  Citrobacter amalonaticus Y19
Brite
KEGG Orthology (KO) [BR:cama00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    F384_02775
Enzymes [BR:cama01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     F384_02775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: AKE58146
UniProt: A0A0F6TTM9
Position
629896..630684
Genome map
AA seq 262 aa AA seqDB search
MFVAAGQFAVSPVWEKNADTCVALMSQAAENGVSLLVLPEALLARDDSDPDLSVKSAQYV
EGDFLKQLLRESASNRMTTILTLHVPSSPGRATNTLVALRGGKVVASYAKLHLYDAFSIQ
ESRNVDAGDTIAPLLDVEGLKVGLMTCYDLRFPELSMALALQGAEVLALPAAWVRGALKE
HHWSTLLAARALDTTCYMIAAGECGNKNIGQSRIIDPFGVTIAAAADVPALVMAEISAER
IRQVRAQLPVLRNRRFVPPQLS
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgttcgttgctgctgggcaatttgccgtcagccctgtgtgggaaaagaacgcggatacc
tgcgtcgcgctcatgtcgcaggcggcggaaaacggcgtgtcgctgctggttctgccggag
gcattgctggcgcgagacgattcggatcccgacctgtcagtgaaatccgcccagtatgta
gagggggatttcctgaaacagctgctgcgggaaagcgcatcgaataggatgaccactatt
ctcacgcttcatgttccgtcgagcccgggtcgtgcgacgaacacgctggtggcactgcgc
ggggggaaagtcgtggcaagctatgccaagctacatctttatgatgcattctccattcag
gagtcccggaatgttgacgctggcgacaccattgcgccactgcttgacgttgaggggctt
aaagtagggctgatgacctgctacgacctgcgctttcccgaattgtcgatggcgcttgca
ttgcagggcgcggaagtcctggcgctgcctgcggcctgggtcagaggggcgttgaaggaa
caccactggtcaacactgttggctgcccgagcgcttgatactacctgctatatgattgcc
gcaggggagtgtggcaacaaaaacatcggtcagagtcgtattatcgacccctttggcgtg
acgattgcggctgcggcagacgtcccggcgcttgttatggcggagatctccgcagagcgg
atccgccaggtgcgggcacaattaccggtattacgaaaccgcagatttgtgccaccgcaa
ttatcatga

DBGET integrated database retrieval system