KEGG   Citrobacter amalonaticus Y19: F384_03195Help
Entry
F384_03195        CDS       T03934                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
cama  Citrobacter amalonaticus Y19
Pathway
cama00020  Citrate cycle (TCA cycle)
cama00640  Propanoate metabolism
cama00660  C5-Branched dibasic acid metabolism
cama01100  Metabolic pathways
cama01110  Biosynthesis of secondary metabolites
cama01120  Microbial metabolism in diverse environments
cama01130  Biosynthesis of antibiotics
cama01200  Carbon metabolism
Module
cama_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cama_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cama00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    F384_03195 (sucC)
   00640 Propanoate metabolism
    F384_03195 (sucC)
   00660 C5-Branched dibasic acid metabolism
    F384_03195 (sucC)
Enzymes [BR:cama01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     F384_03195 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A BAT
Motif
Other DBs
NCBI-ProteinID: AKE58218
UniProt: A0A0F6REF6
Position
716949..718115
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFARYGLPAPVGYACTTPREAEEAASKIGAGPWVVKCQVHAGGRGKAGGV
KVVKSKEEIRAFAEHWLGKRLVTYQTDANGQPVNQILVEAATDIDKELYLGAVVDRSSRR
VVFMASTEGGVEIEKVAEETPHLIHKVALDPLTGPMPYQGRELAFKLGLEGKLVQQFTKI
FMGLATIFLERDLALIEINPLVITKQGDLICLDGKLGADGNALFRQPDLREMRDQSQEDP
REAQAAQWELNYVALDGNIGCMVNGAGLAMGTMDIVKLHGGEPANFLDVGGGATKERVTE
AFKIILSDDNVKAVLVNIFGGIVRCDLIADGIIGAVAEVGVNVPVVVRLEGNNAELGAKK
LADSGLNIIAAKSLTDAAQQVVAAVEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacatgaataccaggcaaaacaactttttgcccgctatggcttaccggcgccg
gtgggttatgcctgtactactccgcgtgaagctgaagaagcggcatcgaaaatcggtgca
ggtccgtgggtagtaaaatgtcaggttcacgcgggcggccgcggtaaagcgggcggtgtg
aaagtggtcaaaagcaaagaagagattcgcgcttttgctgaacactggctgggcaaacgt
ctggtgacctatcaaacagacgccaacggtcaaccggtaaaccagattctggttgaagca
gcgaccgatatcgataaagagctgtatctgggcgcggtggttgaccgtagctctcgtcgc
gtggtcttcatggcctccaccgaaggcggcgtagaaattgaaaaagtcgcggaagaaacc
ccgcacctgatccacaaagttgcgcttgatccgctgaccggcccaatgccgtatcaggga
cgtgagctggcgttcaaactgggtctggaaggcaaactggttcagcaattcactaaaatc
tttatggggctggcgacgattttcctggagcgcgacctggcgctgatcgaaatcaacccg
ctggtcatcaccaaacagggcgacctgatctgcctcgacggcaaactgggcgctgacggc
aacgcgctgttccgccagccggatctgcgtgaaatgcgcgaccagtctcaggaagacccg
cgtgaagcgcaggctgcacagtgggaactgaactacgtcgcgctggatggcaacatcggc
tgcatggttaacggcgcaggtctggcgatgggcaccatggacatcgtgaaactgcacggc
ggcgaaccggctaacttccttgacgttggcggcggcgcaaccaaagagcgcgtgaccgaa
gcgttcaaaattatcctctctgacgacaacgttaaagcggttctggttaacatcttcggc
ggtattgtgcgctgcgacttgatcgctgacggcattatcggcgcggtagcggaagtgggt
gttaacgtaccggttgtggttcgtctggaaggcaacaacgccgaactcggcgcgaagaaa
ctggctgacagcggcctgaatattattgcagcgaaaagtctgacggatgcagctcagcag
gttgttgccgcagtggaggggaaataa

DBGET integrated database retrieval system