KEGG   Citrobacter amalonaticus Y19: F384_04875Help
Entry
F384_04875        CDS       T03934                                 

Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
cama  Citrobacter amalonaticus Y19
Pathway
cama00780  Biotin metabolism
cama01100  Metabolic pathways
Module
cama_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:cama00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    F384_04875
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cama01007]
    F384_04875
Enzymes [BR:cama01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     F384_04875
Amino acid related enzymes [BR:cama01007]
 Aminotransferase (transaminase)
  Class II
   F384_04875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 Cys_Met_Meta_PP Mur_ligase Beta_elim_lyase OKR_DC_1 DegT_DnrJ_EryC1 Speriolin_C
Motif
Other DBs
NCBI-ProteinID: AKE58525
UniProt: A0A0F6REG2
Position
1082674..1083846
Genome map
AA seq 390 aa AA seqDB search
MSLYDKFSRLASEREQFRMTGVNPFGTCIDEVFSATEGRIGNQKIILAGTNNYLGLTFNA
QAIAEGQAALANQGTGTTGSRMANGSYGPHLALEQEIAAFFGRSSAIVFSTGYTANLGII
STLANHNAVVLLDADSHASIYDACTLGGAEIIRFRHNDAKDLERRMVRLGERAKDAIIIV
EGIYSMLGDIAPLVDIVDIKKRLGGFLIVDEAHSFGVMGATGRGLAEAMGVEQGVDIIVG
TFSKSLASIGGFAVGDQGMDVLRYASRPYIFTASPSPSSIATVRSALKTIAAQPELRQKL
WDNAVRLYEGLEKLGYELSSHISPVVPVIIGTKEEGLSAWRELIAAGVYVNLILPPAAPA
GITLLRCSVNAAHTDEQIDMIIQAFAQLKK
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgagtctttatgataaattctcgcgccttgccagcgagcgggaacaatttcgaatgacg
ggggttaacccatttggcacatgtatagatgaagtgttttctgcaacggaagggcggatt
ggcaaccaaaagattattctggcgggtaccaataactatctgggactcacttttaatgcg
caggcgattgctgaggggcaggcagcattagctaaccaggggacgggaacgaccggttcg
cggatggcgaacggcagttatggaccgcacttagcgttagaacaggagattgccgcgttt
tttggtcggtcgtcggccattgtcttctccacgggctataccgcaaatttagggataatc
agcacgcttgccaatcataatgcggtggtactgctggatgctgatagccacgccagcatt
tatgatgcctgtacgttgggcggcgcagaaattatccgttttcgccataacgatgcgaaa
gatctggaacgacgtatggtgcgccttggtgagcgcgccaaagacgccatcatcattgtc
gaaggcatatacagtatgttgggcgacatcgcgccactggtcgacattgtcgacatcaaa
aaacggctgggcggttttttgatcgttgatgaagcacactcttttggcgtgatgggcgcg
acggggcggggactggcggaagcgatgggggtagagcagggtgtcgacatcattgtggga
accttcagtaagagcctggcttccattggtggttttgccgtaggcgatcagggcatggat
gttttgcgttatgccagtcgcccctatatttttaccgcatcgccttcgccgtcgagcatt
gcaaccgttcgttcggcgttaaaaacgatcgccgcacaaccggagttgcgccaaaagttg
tgggataacgcagtgcgattgtatgaagggcttgagaaactgggttatgagttgagttcg
cacatcagtcccgtggttccggttattatcggtaccaaagaagaggggttgagtgcctgg
cgcgaactgattgctgcaggcgtttacgtgaatctcattttgccaccggcagcacccgcc
gggattacgttgctacgctgcagcgttaatgctgcacataccgacgagcagattgacatg
attattcaggcatttgcgcagctaaaaaaatga

DBGET integrated database retrieval system