KEGG   Citrobacter amalonaticus Y19: F384_05850Help
Entry
F384_05850        CDS       T03934                                 

Definition
(GenBank) selenophosphate synthetase
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
cama  Citrobacter amalonaticus Y19
Pathway
cama00450  Selenocompound metabolism
cama01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cama00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    F384_05850
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cama03016]
    F384_05850
Enzymes [BR:cama01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     F384_05850
Transfer RNA biogenesis [BR:cama03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    F384_05850
 Prokaryotic Type
    F384_05850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: AKE58702
UniProt: A0A0F6TUQ9
Position
1277209..1278252
Genome map
AA seq 347 aa AA seqDB search
MSEHAIRLTQYSHGAGCGCKISPKVLETILHSEQAKFVDPNLLVGNETRDDAAVYDLGNG
TSVISTTDFFMPIVDNPFDFGRIAATNAISDIFAMGGKPIMAIAILGWPISKLSPEIARE
VTEGGRFACRQAGIALAGGHSIDAPEPIFGLAVTGIVPTERVKKNSTAHAGCKLFLTKPL
GIGVLTTAEKKSLLKPEHQGLATEVMCRMNIAGASFANIDGVKAMTDVTGFGLLGHLSEM
CQGAGVQAQICYQDIPKLPGVEEYIRLGAVPGGTERNFASYGHLMGEMPQAVRALLCDPQ
TSGGLLLAVTPEAEEEVKATAAEFGIEMSAIGELVEARGGRAMVEIR
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagcatgctattcgtttaacgcagtacagccacggagcgggttgcggttgtaaa
atttccccgaaagtgctggaaaccatcctgcacagcgagcaggcgaagtttgtcgacccg
aacctgcttgtgggaaatgaaacccgcgacgacgcggcggtgtacgatctgggcaatggc
accagcgtcatcagtaccaccgacttctttatgccgattgtcgataatccgtttgatttt
ggccgcattgcggcgaccaacgccattagcgatattttcgcgatgggcggcaaaccgatt
atggcgatcgcgatcctgggctggcctatcagcaagctgtcgccggaaattgcccgcgaa
gtgaccgaaggcggacgctttgcctgccgtcaggcgggtattgcgctggcgggcggacac
tcgattgacgcgccggaaccgatcttcggtctggccgtaaccggcattgtccccaccgaa
cgggtgaagaaaaacagtaccgcccatgccggctgtaaactgttcctgaccaaaccgttg
ggcattggcgtgctgaccactgcagagaaaaaatcgctgctgaaacctgaacatcagggg
ctggcaacggaagtgatgtgccggatgaacattgccggggcgtcatttgccaacatcgac
ggtgtgaaagccatgaccgatgtgaccggctttggtctgctgggccatctcagcgagatg
tgccagggcgcaggcgtacaggcgcagatctgttatcaggacatccctaaactgccgggc
gtggaagagtacatccgcctgggcgccgtgccgggtggcacagagcgtaactttgccagc
tacggacacctgatgggtgaaatgccgcaggcggtgcgcgcgctgctgtgcgatccgcaa
acgtccggcggcctgctgctggcggtgacgccagaggccgaagaagaagtcaaagcgact
gccgcagagtttggtattgagatgagcgccattggcgaactggttgaagcccgtggcggt
cgcgccatggttgagatccgttaa

DBGET integrated database retrieval system