KEGG   Citrobacter amalonaticus Y19: F384_07960Help
Entry
F384_07960        CDS       T03934                                 

Definition
(GenBank) exoribonuclease II
  KO
K01147  exoribonuclease II [EC:3.1.13.1]
Organism
cama  Citrobacter amalonaticus Y19
Brite
KEGG Orthology (KO) [BR:cama00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cama03016]
    F384_07960
Enzymes [BR:cama01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     F384_07960
Transfer RNA biogenesis [BR:cama03016]
 Prokaryotic Type
  3'processing and CCA adding factors
   3'processing factors
    F384_07960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNB OB_RNB S1 CSD2
Motif
Other DBs
NCBI-ProteinID: AGE94439
UniProt: M1KH17
Position
1770457..1772391
Genome map
AA seq 644 aa AA seqDB search
MFQDNPLLAQLKQQLHSQTPRAEGVVKATEKGFGFLEVDAQKSYFIPPPQMKKVMHGDRI
IAVIHTEKDRESAEPEELVEPFLTRFVGKVQGKNDRLSIVPDHPLLKDAIPCRAARGVDH
EFKEGDWAVAEMRRHPLKGDRTFYAELTQFITFADDHFVPWWVTLARHNLEKEAPDGVAT
EMLDEGLERQDLTALNFVTIDSASTEDMDDALYAEELADGKLQLTVAIADPTAWIAEGSK
LDSAAKIRAFTNYLPGFNIPMLPRELSDDLCSLRANEVRPVLACRMTIAADGAIEDDITF
FAATIESKAKLAYDNVSDWLENSGSWQPESEEIAQQIRLLQRICLNRGEWRHHHALVFKD
RPDYRFILGEKGEVLDIVAEPRRIANRIVEESMIAANICAARVLRDKLGFGIYNVHLGFD
PANADALAALLQSHGMHVDAEEVLTLEGFCKLRRELDAQPSGFLDSRIRRFQSFAEISTE
PGPHFGLGLEAYATWTSPIRKYGDMINHRLLKAVIKGESISRPQEEVTVQMAERRRLNRM
AERDVGDWLYARFLSDKAGTDTRFAAEIIDVSRGGMRVRLVDNGAVAFIPAPFLHAVRDE
LVCSQESGTIQIKGETVYKVTDVIDVTIAEVRMETRSIIARPAA
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaggacaacccgctgctagcgcagcttaaacagcaactgcattcccaaacgcca
cgcgccgaaggggtggtaaaagccacggaaaagggctttggcttcctggaagtcgatgcg
caaaaaagttatttcatccccccgccgcagatgaaaaaagtgatgcatggtgaccgtatc
atcgccgtcatccacactgaaaaagatcgtgaatctgcggaaccggaggaactggttgag
ccgttcctgacccgttttgtcggtaaagtgcagggtaagaacgatcgcctgtccatcgtg
ccggatcatccgctgttgaaagacgctatcccctgccgcgccgcacgcggtgtggaccat
gaatttaaagagggtgactgggccgttgctgaaatgcgccgtcatccactcaaaggcgac
cgcaccttctacgctgaattaacccagttcatcactttcgctgacgaccactttgtaccg
tggtgggtcaccctggcgcgtcacaatcttgagaaagaagcgccggacggcgtggcgacg
gaaatgctggatgaaggtctggaacgtcaggatctgacagcgctgaattttgtcaccatc
gacagcgccagcacagaagatatggacgatgcgctgtatgctgaagaactggccgacggc
aaactgcaactgaccgtggcgattgccgatcctaccgcctggatagccgaaggcagtaag
ctggatagcgccgcgaagatccgtgcgttcaccaactatttgccaggcttcaatattccg
atgctgccgcgcgagctgtctgacgacctttgctcgctgcgcgccaatgaagtgcgtccg
gtgctcgcctgtcgcatgaccattgccgcagatggcgccatcgaagatgacatcacattc
ttcgccgccacgattgagtcaaaagcgaaactggcttatgacaacgtctctgactggctg
gaaaatagcggtagctggcagcctgaaagcgaagaaatcgcgcagcagattcgcctgctg
caacgcatttgcctgaaccgcggcgagtggcgtcatcaccatgctctggtgtttaaagat
cgccctgactaccgcttcattctcggtgaaaaaggcgaagtgctcgatatcgttgcagag
ccgcgccgtatcgcgaaccggattgtcgaagagtcaatgattgccgccaacatctgtgcc
gcacgcgtgctgcgcgacaaactcggctttggcatttacaacgttcatctgggctttgat
ccggccaatgccgacgcgctggccgcgctgctgcaatcccacgggatgcatgtggatgcc
gaagaagtattgaccctcgaaggcttttgcaaactgcgtcgtgaactggatgcacaaccg
tcgggtttcctcgacagccgcattcgtcgcttccagtcctttgcggaaatcagcaccgag
ccgggcccgcactttgggctgggtctggaggcttacgccacctggacgtcgccgattcgc
aaatatggcgatatgatcaaccatcgtctgctgaaggccgtcatcaaaggcgaaagcatt
agccgtccacaggaagaggtcaccgtacagatggcagagcgccgtcgcctgaaccggatg
gcggaacgcgatgttggcgactggctgtatgcccgtttcctgagcgataaagccgggacg
gatacccgcttcgcggcggagatcatcgatgtcagccgtggtgggatgcgtgtacgcctg
gtggataacggtgcggttgcttttatccctgcgccattcctgcacgccgtacgtgacgaa
ctggtttgcagccaggaaagcggcaccatccagattaaaggtgaaaccgtctataaagtg
acggatgtgattgatgtcaccatcgccgaagtgcgaatggaaacccgcagcatcatcgcc
cgtcctgccgcctga

DBGET integrated database retrieval system