KEGG   Citrobacter amalonaticus Y19: F384_13845Help
Entry
F384_13845        CDS       T03934                                 

Definition
(GenBank) nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
cama  Citrobacter amalonaticus Y19
Pathway
cama00230  Purine metabolism
cama00240  Pyrimidine metabolism
cama01100  Metabolic pathways
cama01110  Biosynthesis of secondary metabolites
cama01130  Biosynthesis of antibiotics
Module
cama_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
cama_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
cama_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
cama_M00053  Pyrimidine deoxyribonuleotide biosynthesis, CDP/CTP => dCDP/dCTP,dTDP/dTTP
Brite
KEGG Orthology (KO) [BR:cama00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    F384_13845
   00240 Pyrimidine metabolism
    F384_13845
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cama04131]
    F384_13845
Enzymes [BR:cama01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     F384_13845
Membrane trafficking [BR:cama04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    F384_13845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: AKE59564
UniProt: A0A0F6TVM6
Position
complement(2994778..2995209)
Genome map
AA seq 143 aa AA seqDB search
MAIERTFSIIKPNAVAKNVIGNIFARFEAAGFKIVGTKMLHLSVEQARGFYAEHDGKPFF
DGLVEFMTSGPIVVSVLESENAVQRHRDLLGATNPANALAGTLRADYADSFTENGTHGSD
SVESAQREIAYFFGEGEVCARTR
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atggctattgaacgtactttttccatcatcaagccaaacgcggtggcaaaaaacgttatt
ggtaatatctttgcgcgctttgaagcagcagggttcaaaattgtcggcaccaaaatgctg
cacctgagcgttgagcaggcgcgcggcttctacgctgagcatgacggcaagccgttcttc
gacggtctggttgagttcatgacctcgggtcctattgtggtgtccgtgctggaaagcgaa
aacgcggtacagcgtcaccgcgatctgctgggcgcaaccaacccggctaacgccctggcg
ggtacgctgcgtgctgactacgctgacagcttcactgaaaacggtactcacggttctgat
tccgtggaatccgcccagcgcgaaatcgcctatttcttcggtgaaggcgaagtgtgcgcc
cgcacgcgctaa

DBGET integrated database retrieval system