KEGG   Citrobacter amalonaticus Y19: F384_15125Help
Entry
F384_15125        CDS       T03934                                 

Definition
(GenBank) tRNA pseudouridine synthase C
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
cama  Citrobacter amalonaticus Y19
Brite
KEGG Orthology (KO) [BR:cama00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cama03016]
    F384_15125
Enzymes [BR:cama01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     F384_15125
Transfer RNA biogenesis [BR:cama03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    F384_15125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AKE59798
UniProt: A0A0F6RG87
Position
complement(3288961..3289755)
Genome map
AA seq 264 aa AA seqDB search
MLEILYQDEWLVAVNKPSGWLVHRSWLDRDEKVVVMQTVRDQIGQHVFTAHRLDRPTSGV
LLMGLSSEAGRRLAQQFEQHQMQKRYHAIVRGWLMEEAVLDYPLVEELDKIADKFARENK
DPQPAVTHYRGLATVEMPVATGRYPTTRYGLVELDPQTGRKHQLRRHLAHLRHPIIGDSK
HGDLRQNRSAAEYFGCNRLMLHASQLSLTHPFTGEPLTIHAGLDTVWMQALSHFGWQGLL
PENERVELSEPAGQDEGISSSSRE
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgctggaaattttgtatcaggacgagtggctggttgcggtcaacaaaccatccggctgg
ctggtgcaccgcagttggctggatcgcgacgaaaaagtggtggtgatgcaaaccgtgcgt
gaccagattggtcagcatgtgtttaccgcccatcgcctcgacagaccgacatccggtgtg
ctgctgatggggttatccagcgaagccggacgccgtctcgcgcagcagtttgagcaacat
cagatgcaaaaacgctatcacgctattgtccgtggatggttgatggaggaggcggtactc
gattatccgctggtggaagaactggataaaatcgccgataagtttgcccgcgaaaacaag
gacccgcagcctgccgtgacccattaccgcggtctcgctaccgttgaaatgcccgtggcg
accggacgttatccgacgacgcgttacggactggtggaactggatccacaaacaggacgc
aaacatcagctcagacgtcatctggcgcacctgcgccatccgattattggcgacagcaag
catggcgatttgcgacagaaccgcagcgcggcggaatactttggctgcaaccggctgatg
ctgcacgccagtcagctttcgctgacgcatccgtttaccggtgaaccgttgacgattcat
gcggggctggatacggtctggatgcaggcattatcacactttggctggcagggacttctc
cctgagaatgaaagggttgagttaagtgagccagcaggtcaggatgaaggaataagttct
tcatccagggagtaa

DBGET integrated database retrieval system