KEGG   Citrobacter amalonaticus Y19: F384_15415Help
Entry
F384_15415        CDS       T03934                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cama  Citrobacter amalonaticus Y19
Pathway
cama00071  Fatty acid degradation
cama00072  Synthesis and degradation of ketone bodies
cama00280  Valine, leucine and isoleucine degradation
cama00310  Lysine degradation
cama00362  Benzoate degradation
cama00380  Tryptophan metabolism
cama00620  Pyruvate metabolism
cama00630  Glyoxylate and dicarboxylate metabolism
cama00640  Propanoate metabolism
cama00650  Butanoate metabolism
cama00900  Terpenoid backbone biosynthesis
cama01100  Metabolic pathways
cama01110  Biosynthesis of secondary metabolites
cama01120  Microbial metabolism in diverse environments
cama01130  Biosynthesis of antibiotics
cama01200  Carbon metabolism
cama01212  Fatty acid metabolism
cama02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cama00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    F384_15415
   00630 Glyoxylate and dicarboxylate metabolism
    F384_15415
   00640 Propanoate metabolism
    F384_15415
   00650 Butanoate metabolism
    F384_15415
  09103 Lipid metabolism
   00071 Fatty acid degradation
    F384_15415
   00072 Synthesis and degradation of ketone bodies
    F384_15415
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    F384_15415
   00310 Lysine degradation
    F384_15415
   00380 Tryptophan metabolism
    F384_15415
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    F384_15415
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    F384_15415
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    F384_15415
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cama04147]
    F384_15415
Enzymes [BR:cama01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     F384_15415
Exosome [BR:cama04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   F384_15415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AKE59849
UniProt: A0A0F6TW89
Position
complement(3353441..3354619)
Genome map
AA seq 392 aa AA seqDB search
MKEVVIVGALRTPIGCFQGTLARHSAVELGSMVVKALIEGSGVNAHAVDEVILGQVLTAG
AGQNPARQSAIKGGLPNTVSAITINDVCGSGLKALHLATQAIQCGEADIVIAGGQENMSR
APHVLTDSRTGAQLGNSQLVDSLVHDGLWDAFNDYHMGVTAENLAREYGISRELQDAYAL
SSQQKARAAIDAGRFKAEIVPVATQRNGQTVIIDTDEQPRTDASAEGLARLDPAFELSGS
VTAGNASSINDGAAAVMMMSESKAQELNLPVLARIRAFASVGVDPALMGIAPVYATRRCL
ERVGWQLADVDLIEANEAFAAQALSVGKMLEWDERRVNVNGGAIALGHPIGASGCRILVS
LVHEMVKRNARKGLATLCIGGGQGVALAIERD
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaggtggtaatcgtcggggcgttgcgtacgcctattggttgttttcaggggacg
ctggcgcgtcattctgccgttgagctgggcagtatggtggtcaaagcgttgattgaaggc
agcggcgtgaatgcgcatgccgttgatgaagtgatcctcgggcaggtgctgacggcgggg
gcggggcaaaacccggcgcgtcagtcagcaatcaaagggggattaccgaacaccgtttct
gctatcaccatcaacgacgtttgtggctccgggctgaaagcgctgcatctcgccacgcag
gcgatccagtgcggcgaagcggacattgtgattgccggtgggcaagagaacatgagccgc
gcgccgcatgtcctcaccgacagccgaaccggcgcgcagttgggcaacagccagctcgtt
gacagcctggtgcatgacggcctgtgggatgccttcaatgattaccatatgggcgtgacc
gccgagaatctggcccgtgaatatggcatcagccgggaattgcaggatgcctatgccctc
agttcgcagcaaaaggcgcgtgcggccattgatgccggtcgttttaaagcggagattgtc
ccggttgcaactcagcgcaatgggcaaaccgtgatcattgacaccgacgagcagccgcga
actgatgccagcgcagaaggtctggcgcggctggatcccgccttcgaactgtcagggtcg
gtgactgcgggtaatgcttcctcgattaatgatggcgcggcggcggtgatgatgatgagc
gagtccaaagcgcaggagctgaatttgcctgtgctggcgcgcattcgcgcttttgcgagc
gtcggcgtggatcccgcgctaatggggatcgcccccgtctatgccactcgccgctgtctg
gaacgggtcggctggcaactggccgatgtggatctcattgaagcgaacgaggcgtttgcc
gcccaggcgctttccgtgggcaaaatgctggagtgggacgagcgccgggtgaacgtcaac
ggcggggcgatcgcccttggacacccgattggcgcttccggttgtcgtattctggtttca
ctggtgcacgaaatggtcaaacgcaatgcccgcaaaggtctggcgacgctgtgcattggc
ggtgggcaaggcgtggcattagccatcgagcgcgattaa

DBGET integrated database retrieval system