KEGG   Citrobacter amalonaticus Y19: F384_15830
Entry
F384_15830        CDS       T03934                                 

Definition
(GenBank) xanthine dehydrogenase
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
cama  Citrobacter amalonaticus Y19
Pathway
cama00230  Purine metabolism
cama01100  Metabolic pathways
cama01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cama00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    F384_15830
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: AKE59921
UniProt: A0A0F6TWN5
Position
3441990..3442469
AA seq 159 aa
MNDTNRITLECVVNGHPFQLSIQAGMPLSELLREQGLLSVKQGCCVGECGACTVLVDGTA
IDSCLYLAAWAAGKEIRTLEGESAGGQLSQVQMAYARSGAVQCGFCTPGLIMATTAMLAK
PREQPLTILEIRRGLAGNLCRCTGYQMIVDTVQRCTEPE
NT seq 480 nt   +upstreamnt  +downstreamnt
atgaatgacactaaccgaattacgctggaatgcgtcgttaatggtcacccttttcagctc
agcattcaggcgggaatgccgctttctgaactcctgcgcgaacaagggttgctgagcgtt
aaacagggatgctgtgtcggtgaatgcggtgcctgtacggttctggttgacggtacagcc
attgacagttgcctgtatcttgccgcgtgggcagcaggaaaagagatccgcacactggaa
ggcgaatcggctggtggccaactctcgcaagtccagatggcttatgccagatccggtgcc
gtgcagtgcggtttttgcacaccgggtttgattatggcgaccaccgcgatgctggcaaag
ccgcgggaacagccgttaaccattctggagatccgtcgcggacttgcgggaaatctgtgt
cgttgcaccggttatcagatgattgtcgataccgtacagcgctgtactgagccggaataa

DBGET integrated database retrieval system