KEGG   Citrobacter amalonaticus Y19: F384_17720Help
Entry
F384_17720        CDS       T03934                                 

Definition
(GenBank) N-acetylneuraminate lyase
  KO
K01639  N-acetylneuraminate lyase [EC:4.1.3.3]
Organism
cama  Citrobacter amalonaticus Y19
Pathway
cama00520  Amino sugar and nucleotide sugar metabolism
cama01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cama00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    F384_17720
Enzymes [BR:cama01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.3  N-acetylneuraminate lyase
     F384_17720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHDPS
Motif
Other DBs
NCBI-ProteinID: AKE60261
UniProt: A0A0F6TXD4
Position
complement(3859069..3859962)
Genome map
AA seq 297 aa AA seqDB search
MAKDLRGVMPALLTPFDNQQKLDIESLRRLVRFNIAQGIDGLYVGGSTGEAFVQNGAERE
QVLEVVAEEAKGKVTLIAHVGTVSTHESQQLARAAHRYGFDAVSAVTPFYYPFSFEEHCD
HYRAIIDSADGLPMVVYNIPALSGVKLTLDQINTLVTLPGVGALKQTSGDLFQMEQIRRA
HPDLVLYNGYDEIFASGLLAGADGGIGSTYNIMGWRYLGIVKALKEGDIRTAQKLQTECN
KVIDLLIKAGVFRGLKTVLHYMDVVSVPLCRKPFAPVDEKYVPALKALAEQLMAERS
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagatttacgaggcgtaatgccagcgttgttaacccccttcgataaccaacag
aaactggatattgaaagcctgcgccgactggtgcgttttaacatcgctcagggtattgat
gggctgtacgtaggcggttccaccggcgaagcctttgtgcagaacggtgcggaaagagag
caggtgctggaagtggtcgcggaagaggcgaagggcaaggtgacgcttatcgctcatgtt
ggaacggtcagcactcacgagagccaacaactcgctcgcgcagcgcatcgttacggcttt
gacgctgtctctgcggtgacgccgttctactatccgttcagctttgaagaacactgcgat
cattaccgggccatcattgattcggcggatggcttgccgatggtggtctataacattccg
gcgctgagtggcgtgaagttaacgctggatcagatcaacacgctggtgacgttgccaggc
gttggcgcactgaaacaaacgtcgggcgatctgtttcagatggaacagatccgtcgcgcc
catccggatctggtgctctataacggttatgacgaaattttcgcttctggcctgctggcc
ggagcggacggcggtatcggcagcacttacaacatcatgggctggcgatatctgggaatt
gtgaaagcgctcaaagaaggcgacatccggactgcgcaaaagctgcaaacagagtgcaat
aaggttatcgatctcctcattaaggccggcgtgttccgtgggctgaaaacggttctgcac
tatatggacgtggtttctgtaccactgtgccgtaagccgtttgcccctgtggatgaaaaa
tacgtgcctgcactgaaagcactggcggaacaattgatggcggaacgttcctga

DBGET integrated database retrieval system