KEGG   Citrobacter amalonaticus Y19: F384_21020Help
Entry
F384_21020        CDS       T03934                                 

Definition
(GenBank) alpha-D-glucose-1-phosphatase
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
cama  Citrobacter amalonaticus Y19
Pathway
cama00010  Glycolysis / Gluconeogenesis
cama01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cama00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    F384_21020
Enzymes [BR:cama01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     F384_21020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Acid_PPase Hydrolase_like HAD PNK3P SHOCT
Motif
Other DBs
NCBI-ProteinID: AKE60866
UniProt: A0A0F6TXY1
Position
4558513..4559112
Genome map
AA seq 199 aa AA seqDB search
MLYIFDLGNVIVDIDFNRVLGTWSDLSRVPLASLKQSFTMGEAFHQHERGEITDEAFAEA
LCHEMDLSLSYEQFSHGWQAVFVALRPEVIDIMQKLREQGHRVVVLSNTNRLHTTFWPDE
YPEIRRVADHIYLSQELGMRKPEARIYQHVLQQEGFSASDTVFFDDNVDNIEGANQLGIT
SILVADKTVIPDYFAKLLC
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgctctatatctttgatttaggaaatgtgattgtcgatatcgacttcaaccgcgtatta
ggtacctggagcgatctgagccgtgtgccgctggcgtcgttaaagcaaagttttacgatg
ggtgaggccttccatcagcacgaacggggcgaaatcaccgacgaagcgtttgccgaggcc
ctttgtcatgagatggatctgtcgctgagctacgaacagttttctcacggctggcaggcc
gtttttgtcgcgctgcgacctgaggttatcgacatcatgcagaaactgcgtgaacagggg
catcgcgtggtcgtcctgtcgaatactaaccggctgcacacgacgttctggccagacgaa
tatccggagattcgccgggtggcggaccatatttatctgtcgcaggagttgggcatgcgc
aaaccggaggcgcggatttatcagcatgtgttacagcaagagggtttttcagcgagcgat
acggtcttttttgacgacaatgtcgataatatagaaggcgccaaccagttggggataacc
agcattctggtggctgataaaaccgtcatcccggattatttcgcgaagctgttatgctaa

DBGET integrated database retrieval system