KEGG   Corynebacterium ammoniagenes: CAMM_04740Help
Entry
CAMM_04740        CDS       T05164                                 

Definition
(GenBank) glutamine-synthetase adenylyltransferase
  KO
K00982  [glutamine synthetase] adenylyltransferase / [glutamine synthetase]-adenylyl-L-tyrosine phosphorylase [EC:2.7.7.42 2.7.7.89]
Organism
camg  Corynebacterium ammoniagenes
Brite
KEGG Orthology (KO) [BR:camg00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CAMM_04740
Enzymes [BR:camg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.42  [glutamine synthetase] adenylyltransferase
     CAMM_04740
    2.7.7.89  [glutamine synthetase]-adenylyl-L-tyrosine phosphorylase
     CAMM_04740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GlnE GlnD_UR_UTase DUF294_C DUF294
Motif
Other DBs
NCBI-ProteinID: APT82246
UniProt: D5P0X1
Position
1021420..1024560
Genome map
AA seq 1046 aa AA seqDB search
MTRIDLPSPATLGLSRPTAAEDLKELGWDHEAAVPLVWCIAAAGDPDGALNTMVRIYSSF
DESEKERLTQALIDDEALRVRLIALLGGSTALGDHLAANPQLWEELVLPLPEPTEMMQEL
LGVIDAQPASYLESEQNAADSASADPASEDLSTPGTYRARIEEAEARPLLKSTYRTLMMR
LAAHDLAGSFYSRKGQTQGQPTVEFRTVTALTTALADAALTAALALAVRTVCGDDDLPMQ
LAVIAMGKCGAKELNYISDVDVIFVGEPVAAGDEEGQKAMRKATRVAAEFNRIGTNCFFE
VDANLRPEGKSGALVRTLDSHVKYYKRWAETWEFQAQLKQRPQTGFMPLGQQYAETIGPM
VWEASQRESFVEDVQSMRRRVLESVPDSLKNRELKLGVGGLRDVEFAVQLLQLVHGRSDE
SLRTLATVDALEALISAGYVGREDGNQLIEAYEFLRLLEHRLQLERFRRTHTMPPNDDKD
TLEWLANVSGFTAQGANSASTMMNKYLKTVRLQISELHSRLFYRPLLNSVVSMSPEELRL
TPQAAKLQLAALGYQAPDRAFEHLTALAAGSSRKARIQAILLPTLMEWLAETADPDAGLL
NYRKLSDAAFDRTWFLRMLRDEGIVGKRLMRILGTSPYTADLIIAAPEVVKQLSDGSDGP
KLLDTTPEQVSSALLSAAKRHSDPDKAVSVARSLRRVELARIASGDLLGYLDVQQVCREL
STIWAAVLEAALRAEIRGWLHSESTEGSSPRPLARIAVIGMGRLGGMELGFGSDADVMVV
AEPAPGVDETRALKWAIGIIDKLRTRLAKPSGDPPLEVDLGLRPEGRSGAIVRTVESFDR
YYQQWGEPWEMQALLRAAFFAGDEEVGQRFIEVIDKYRYPDDGVSQSTIRAIRRMKARVD
NERLPRGADRNTHTKLGRGGLSDVEWTVQLLTMMHAHKHPELHNPSTLGTLDALEETGVL
PAEQVESLREAWLMATDARNALVLVRGKRVDQLPTPGLQLAQVAGAAGWKPEENQYFLDA
YLKATRHARRVVDEVFWGEAETMEPG
NT seq 3141 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcgcatcgatctgccctcaccagctactttagggctcagtaggcccacggcagca
gaagatctcaaagaacttgggtgggatcacgaagccgctgtgccgctggtgtggtgcatc
gccgccgcaggcgatccagatggggcattaaacaccatggtgcgcatctactcatcgttc
gacgagtcagaaaaagagcggctgacgcaggcgcttatcgatgacgaggcgctgcgcgtt
cgcctgatcgcgcttcttggcggatccaccgcgctaggagatcacctcgctgcgaacccg
cagctgtgggaagaattagtgctgccgctgccagagcctaccgagatgatgcaagaactg
ctcggggtcattgacgcacaacctgctagttacctcgagagcgagcagaacgcagctgat
tccgcatcggccgatcccgcatcggaggatctgtccaccccggggacctatcgcgccagg
atagaagaagctgaagcccggcctttgctgaaatccacgtatcggaccttgatgatgcgt
ctggccgcccatgatttggcgggaagcttctactcccgcaagggccaaacccaaggccag
cccaccgtggaatttcgcacggtcactgcgctcaccaccgcgcttgccgatgccgcactc
accgctgctttagcccttgccgtacgcacggtctgcggggacgacgatttgcccatgcag
ttagctgttatcgctatgggcaaatgcggggcgaaagaactgaactacatctcggatgtg
gacgtcatctttgtcggcgagccggtggcagccggtgatgaagaaggccaaaaggccatg
cgcaaggccacgcgggtagcggcggaatttaaccgcatcggtactaattgcttcttcgaa
gtcgatgccaacctgcgcccggaaggtaaatcgggagctttagtccgtaccttggattcc
cacgtgaagtactacaagcgctgggcggagacgtgggagtttcaagcgcagctaaaacaa
cgtccccagaccgggtttatgccactggggcagcagtacgccgagaccatcgggccgatg
gtgtgggaggcatcgcagcgcgaatccttcgttgaagatgtgcaatccatgcgccggcgc
gtattagaaagcgtgccggattcattgaaaaaccgcgagttaaaactcggcgtgggtggt
ctgcgcgatgtggaatttgcggtgcagttactgcaattagtccatggccgctccgacgaa
tctctgcgcacgctcgctaccgtggatgcgctcgaggcgctgatttcggcagggtatgtc
ggccgcgaggacggcaaccagctcatcgaggcgtatgaattcttgcggttattagaacac
cgcttgcagctggagcgctttcgtcgcacgcacaccatgccgccgaatgatgataaagac
accttagagtggctggcgaatgtgtctggatttaccgcccaaggcgctaattcggcatcg
acgatgatgaataagtacttaaagacggtgcgcttgcaaatctccgagctgcactcgcgc
ttgttctaccgtccactgctcaactctgtggtgtccatgagccccgaagagctcaggctc
accccgcaggcagccaagctgcagttggcagctttgggatatcaagcgcccgatcgcgcc
ttcgagcatctcaccgccttggccgcaggttcatcgcgcaaggcgcgtatccaagcgatc
ttgttgccgacgttgatggagtggctagcagagaccgccgacccagatgccggattgctc
aactaccgcaagctgtctgatgccgcctttgaccgaacctggtttttacgcatgttgcgt
gatgagggaatagtcggcaagcgcttaatgcgtatcttaggcacctcgccctataccgcc
gacctcatcattgctgcaccagaagtggttaagcagctttccgatggctccgatggcccg
aagcttttagataccaccccggaacaggtatcttccgcgctgctcagcgcagccaagcgc
cacagtgatccggataaggcagtgagcgtggcgcgctctttacggcgcgtggaactagca
cgcattgcctccggcgatctgctgggctacctcgatgtccagcaagtctgccgggaacta
tctacgatttgggcagcggtgctggaagcagccctgcgcgccgagatccgcggctggctg
catagcgaaagcaccgagggatcctcgccacgtccgctggcgcgcatcgccgtgattggt
atgggacgcctcggtggcatggaattaggctttggctccgatgccgatgtcatggtcgtg
gcagaacctgcgcccggtgtggatgagacgagggcattgaaatgggcgatagggatcatc
gacaagctgcgaacccgccttgccaaaccatcgggtgatccgcccctggaagtggacctc
gggctacgtccggaaggacgctccggggctattgtgcgcacggtggaaagctttgaccgc
tactaccagcaatggggtgagccatgggagatgcaagccctgctgcgtgctgcttttttc
gccggcgatgaagaagtagggcagcggtttatcgaggtgattgataaataccgttatccc
gacgacggagtgtcccagtcaacgattcgcgccattcgccgcatgaaagcccgcgtggat
aatgaacgtctgcctcgtggtgccgaccgcaacacgcacaccaagctcggccgtggtggg
ctaagcgatgtggaatggaccgtgcagcttttaacgatgatgcatgcgcacaagcacccc
gaactgcacaacccgtcgacgctgggcaccttagatgccttggaagaaaccggagtgctg
ccagcagagcaggtcgaaagcctgcgggaagcatggctgatggccaccgatgcccgcaac
gccttggtactcgtgcgcggcaaacgcgtggaccaactgcccaccccagggctgcaactg
gcgcaagtagctggtgctgccggctggaaaccggaagaaaaccaatacttcttggatgcc
tacctcaaagcaacacgacatgcgcgccgggttgtcgatgaagtcttttggggcgaagct
gaaaccatggaacctggctaa

DBGET integrated database retrieval system