KEGG   Corynebacterium ammoniagenes: CAMM_07325Help
Entry
CAMM_07325        CDS       T05164                                 

Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
camg  Corynebacterium ammoniagenes
Pathway
camg00220  Arginine biosynthesis
camg01100  Metabolic pathways
camg01110  Biosynthesis of secondary metabolites
camg01130  Biosynthesis of antibiotics
camg01230  Biosynthesis of amino acids
Module
camg_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:camg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    CAMM_07325
Enzymes [BR:camg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     CAMM_07325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-ProteinID: APT82739
Position
complement(1586842..1587792)
Genome map
AA seq 316 aa AA seqDB search
MRHFLADDDLTPQEQQEVLALALELKKEPFKYRPLEGPKSVALLFSKTSTRTRFSFEAGI
AAIGGHAIMSTDQSSQLGKGESLQDTAAVLSRFTEMIIWRTFAHQNLIDMAETSTVPIIN
SLTDDLHPCQILADLLTCAEEFGGIDKLAGKKAVYLGDGANNMANSYLIGFATAGVDIAI
CAPDDFQPEQHFVDRARDRAEHTGATITITDDTSVVDGTDIIITDTWVSMGQEDDGKDRR
TPFMPYQVNQDLMAKADENAIFLHCLPAYRGNEVTAEVIDGAQSRVFDEAENRLHAQKAL
MVWLLNKAAEAASDKA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atccggcatttcttagctgacgatgacctcaccccgcaagaacagcaggaagttctagcg
ctggcactcgagctgaagaaagaaccttttaagtaccgcccgctggaagggcccaagtct
gtggcgttgttgttttcgaagacgtccacacgtacccggttttcttttgaggccggtatc
gcggcgatcgggggacatgccatcatgtccacggatcaaagctcccagttgggcaaaggc
gaaagcttgcaagataccgcggcggtgttgtcacggtttaccgaaatgatcatctggcgt
accttcgcacaccaaaaccttattgatatggcagagacgtcgaccgtaccgattatcaat
tcgctcacggatgatttgcacccctgccagattttggcggatttgctcacctgcgcggag
gaatttgggggcatcgacaagctagcgggcaaaaaggctgtctacttgggcgatggtgct
aataatatggccaattcttacctcatcggctttgctaccgccggcgtagatattgccatc
tgcgcgcctgatgatttccagccggagcagcactttgtcgaccgtgcgcgcgaccgcgcc
gaacacaccggtgccaccattacaatcaccgatgatacgagcgtggttgatgggacagac
atcatcatcactgatacctgggtatctatgggccaagaagacgacggcaaagaccgtcgc
acgccctttatgccgtaccaggtcaaccaggatctgatggcgaaggctgatgagaacgcg
atcttcttgcactgcttgccggcctaccgcggcaacgaagtcaccgcggaagttatcgac
ggtgcgcagtcacgcgtattcgacgaagcagaaaaccgcctgcacgcgcagaaggctttg
atggtgtggctgttgaataaggcagctgaggctgcctcggacaaggcataa

DBGET integrated database retrieval system