KEGG   Campylobacter fetus subsp. testudinum 03-427: CFT03427_0379Help
Entry
CFT03427_0379     CDS       T02899                                 

Gene name
purA
Definition
(GenBank) adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
camp  Campylobacter fetus subsp. testudinum 03-427
Pathway
camp00230  Purine metabolism
camp00250  Alanine, aspartate and glutamate metabolism
camp01100  Metabolic pathways
Module
camp_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:camp00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CFT03427_0379 (purA)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CFT03427_0379 (purA)
Enzymes [BR:camp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     CFT03427_0379 (purA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: AGZ81266
Position
352240..353490
Genome map
AA seq 416 aa AA seqDB search
MTKADLIVGIQWGDEGKGKIVDMLSQNYDVVCRSGGGHNAGHTIWVDGMRYALHLVPSGI
LHKNIINIIGNGVVVNPEVLISEMAQFDHLEGRFFISDRAHLNLAHHSLIDQAKERLKGD
KAIGTTGKGIGPAYSDKISRSGHRVGELLDPKALCESLMKDFEANKPYFDTLSIEIPPKD
KILADLVRFKDVLAPFITNTTELLWKAMDDNKKVLLEGAQGTLLDIDHGTYPYVTSSNTV
SAGACTGLGLSPKSIGKVIGIIKAYSTRVGNGAFPTEDLGCDGEKMCEIGKEFGTTTGRK
RRCGWLDAVGVKYSSRLNGVDTYALMKLDVLDGFKSVKICKAYEYKGEVIDYFPSDLQNV
TPIYEELEGWDSISGIKKYEDLPLNARKYIERIEELTGVKIGFISTSPERNDTIIR
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaggcggatttgatcgttggaatacaatggggtgatgaaggcaaaggaaaaata
gtagatatgctttcacaaaattatgatgtagtatgtagaagcggtggcggacacaatgca
ggacatactatatgggttgatggtatgagatacgctttgcacctagttccaagcggaatt
ttacataaaaatattataaatattataggaaatggtgttgttgtaaatcctgaagttttg
attagcgagatggctcagtttgatcatttagaaggtagattttttataagcgatagagcg
cacttaaacttagctcatcactcattaatagatcaagccaaagagagattaaaaggtgat
aaagctataggcacgacaggtaagggcataggacctgcatattcagataaaattagcaga
agcggacatagagtgggcgagcttttagatccaaaagcactttgtgagagccttatgaaa
gattttgaagcaaataagccgtattttgatactcttagcatcgaaataccgcctaaagac
aaaattttagctgatttggttagatttaaagatgttttggctccgtttatcacaaataca
actgagcttttgtggaaagctatggatgataataaaaaagttctgcttgaaggagctcaa
ggaactcttcttgatatagatcacggaacatatccgtacgtgactagttcaaataccgta
tctgcaggagcttgcaccggtttaggtcttagtccaaaaagtataggtaaggttattggt
atcataaaggcatattcaactagagttggaaatggtgcttttcctactgaagatcttggc
tgcgatggtgagaaaatgtgcgagataggtaaagagtttggtactacaacaggtagaaaa
agacgttgcggatggcttgatgctgttggcgtaaaatactcttcaagactaaatggagta
gatacttacgctttgatgaaacttgatgttttagatggatttaaaagtgttaaaatttgt
aaagcatatgagtataaaggcgaagttatagattattttccttcagatcttcaaaatgta
actcctatttatgaggaattagaaggttgggatagcataagcggtatcaaaaaatatgag
gatttgcctttaaatgctagaaagtatatagagagaatagaagaattaaccggcgtaaaa
atcggatttatatcaacaagtccagagagaaatgatacgattataagatga

DBGET integrated database retrieval system