KEGG   Campylobacter fetus subsp. testudinum 03-427: CFT03427_1614Help
Entry
CFT03427_1614     CDS       T02899                                 

Gene name
ubiX
Definition
(GenBank) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
camp  Campylobacter fetus subsp. testudinum 03-427
Pathway
camp00130  Ubiquinone and other terpenoid-quinone biosynthesis
camp01100  Metabolic pathways
camp01110  Biosynthesis of secondary metabolites
camp01120  Microbial metabolism in diverse environments
camp01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:camp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    CFT03427_1614 (ubiX)
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    CFT03427_1614 (ubiX)
Enzymes [BR:camp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     CFT03427_1614 (ubiX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AGZ82456
Position
1636283..1636825
Genome map
AA seq 180 aa AA seqDB search
MKTLVAISGASGAHLGIKLANVIASLGNDTHIIISENALISMQKEEVSEQIDKNIRIYSN
NEIWAAPASGSSKFENMIIAPCSINSLAKIASSISDNLILRAAAVMIKEHKKLVLGVREM
PLSAISLRQMADLAALGVIIAPPIIGYYSGIKSLKDMENFVIGKWLDTIEIKHDIFSRWE
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaactttagtagctataagcggtgctagcggtgctcatttagggatcaaactggca
aatgttattgctagtttgggaaatgatacacatattattatcagtgaaaatgcgttgatc
tctatgcaaaaagaggaagttagcgaacaaattgataaaaatatacgaatttattcaaat
aatgaaatttgggctgctccagctagcggttcgtccaaatttgaaaatatgataatcgcg
ccttgttccataaattccttagccaagatagcttctagcatcagcgataatctgatttta
agagcggctgcagttatgataaaagagcataaaaagcttgttttaggcgtaagagagatg
cctttatctgctatcagtcttaggcaaatggcggatttagcagcacttggagttatcata
gcgccgcccattatcgggtattattctgggataaaaagtcttaaagatatggaaaatttc
gtgataggaaagtggctagatactattgaaataaaacacgatattttcagtcgttgggag
tga

DBGET integrated database retrieval system