KEGG   Campylobacter sp. RM16704: CAQ16704_0380Help
Entry
CAQ16704_0380     CDS       T03560                                 

Gene name
purA
Definition
(GenBank) adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
camr  Campylobacter sp. RM16704
Pathway
camr00230  Purine metabolism
camr00250  Alanine, aspartate and glutamate metabolism
camr01100  Metabolic pathways
Module
camr_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:camr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CAQ16704_0380 (purA)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CAQ16704_0380 (purA)
Enzymes [BR:camr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     CAQ16704_0380 (purA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt DUF677
Motif
Other DBs
NCBI-ProteinID: AJC85885
UniProt: A0A0A8GWH5
Position
354818..356068
Genome map
AA seq 416 aa AA seqDB search
MSKADIVVGIQWGDEGKGKIVDKLCENYDYVCRSAGGHNAGHTIWVDGIRYALHLVPSGV
LNKQCINVIGNGVVVNPDVLISEMAQFENLEGRLFISDRAHLNLNHHALIDQARERLKGD
KAIGTTGKGIGPSYEDKISRNGHRVGELLEPEKLCENLMKDFELKKTYFATLGVDMPSYE
VVLKDLKRFKEVLAPYITDTTRMLWKALDEDKKVLLEGAQGSMLDIDHGTYPYVTSSTTI
SAGALSGLGLNPKEIGKVIGIVKAYTTRVGNGAFPSEDLGEDGEKIGLIGKEIGVSTGRK
RRCGWFDAVAVRYTARLNGLDTLSLMKLDVLDGFESVKICKAYEYKGQEIDYVPCDLENA
KPIYEVMEGWDKVAGIRDYDLLPENAKKYIKRLEELSGIKVGYISTSPEREDTIIL
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaagcagatattgtcgttggaatccaatggggtgatgaaggtaagggcaaaata
gtagataaattatgcgaaaattatgattatgtatgcagaagtgcaggcggacataatgcg
ggtcatactatatgggtcgatggtataagatatgctttacatttagttccttctggtgtt
ttaaataaacaatgtattaatgttattggaaatggagttgtggttaatcctgatgtatta
attagcgaaatggctcaatttgaaaatttagaaggaagattgtttataagtgatagagca
catttaaatttaaatcatcatgctttaattgatcaagcaagagaaagacttaagggtgat
aaggctataggtacaactggtaaaggtatagggccaagttatgaagataaaattagccgt
aatgggcatagagtaggtgagcttttagagcctgaaaaattatgtgagaatttaatgaaa
gatttcgaacttaaaaagacttattttgctacacttggtgttgatatgccaagttatgaa
gtggttttaaaagatttaaaacgctttaaagaagttttagcaccatatattacagatact
acaagaatgctttggaaggctttagatgaagataaaaaggtgcttttagaaggtgcacaa
ggttctatgcttgatattgatcatggaacttatccttatgtaactagttcaacaactatt
tcagctggagctttaagtggtttgggattaaatccaaaggaaattggaaaagttataggt
atagtaaaagcttatacaacaagagtaggaaacggagcgtttccaagtgaagatttaggt
gaagatggtgaaaaaataggacttattggaaaagaaattggtgtaagtactggtagaaaa
agaaggtgtggctggtttgatgcggttgctgtaagatatacggcaagattaaatggtttg
gatactttgtctttaatgaaacttgatgttttagatggatttgaaagcgttaagatttgt
aaagcttatgagtataaaggacaagaaatagattatgtgccttgtgacttagaaaacgct
aaacctatttatgaagtaatggaaggctgggataaagttgcaggaattagagattatgat
ttactgcctgaaaatgcaaaaaaatatattaaacgcttagaagagttaagtggaataaaa
gtaggttatatttctacaagtcctgaaagagaagatacaattattttatga

DBGET integrated database retrieval system