KEGG   Campylobacter sp. RM16704: CAQ16704_0917Help
Entry
CAQ16704_0917     CDS       T03560                                 

Definition
(GenBank) inorganic phosphate transporter, PitA family
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
camr  Campylobacter sp. RM16704
Brite
KEGG Orthology (KO) [BR:camr00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    CAQ16704_0917
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 RTX_C SDH_sah
Motif
Other DBs
NCBI-ProteinID: AJC86374
UniProt: A0A0A8H0G9
Position
complement(889052..890572)
Genome map
AA seq 506 aa AA seqDB search
MSKDNAIAFLIFIVSVLCFFVWGYNYIPNNSMILFILASVFGIFMAFNVGGNDVANSFGT
SVGAKTVTIKQALIIAAVFELSGAVFAGGEVTNTIRSGIVILPDGVDPMVFVCVMLSALL
SSGIWLFIATKKGLPVSTTHSIIGGIVGSSIAMGFVFFDQNQAFLMVNWNGIYKIAMSWI
ISPLLGGLVAYLIYAYIYKKILKPSEEITLVVKEIKKEKKAFKEEYFINLKNKSQEEQIK
ELSAIVLDDEENKSQYQLKLKELKEKEKNIDVFSKMKFHVPLIAGVAALIIASMFLFKGL
NKVSTLDVMQNLWIVSIISIFAYIVTLAVVRLMKKTQVNKTIEKIFSWFQIFTASSFAFS
HGANDIANALGPFAAILDVLKNNTINPSSPVPFAVMLMFGIALVIGLWFLGKEVIQTVGS
KLAEIKPTTGFSAELGASIVILLATQLGIPVSSTHILIGAILGIGVFNKDAKWSMMKPIG
LAWIITLPVAGILSSIIFMVFVNIIL
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
ttgagtaaagataatgctattgcatttttaatttttattgtgagtgttttgtgttttttt
gtgtggggttataattatatccctaataattctatgattttatttattcttgccagtgta
tttggaatttttatggcttttaatgttggaggcaatgatgttgcaaattcttttggaact
agcgtaggtgctaaaacagttactattaagcaagccttaatcatcgctgctgtgtttgag
ctaagtggtgctgtatttgcaggtggagaagtcactaataccataagaagtggtatagta
attttacctgatggtgttgatcctatggtgtttgtatgtgtaatgctttcagccttatta
agttcaggaatttggctttttattgcaactaaaaagggacttccagtatcgactactcat
agtattataggcggtattgtaggttcaagtattgctatgggttttgtattttttgatcaa
aatcaagcttttttaatggtaaattggaatggtatttataaaatagctatgagttggata
atttcacctttgcttggtgggcttgtagcgtatttaatttatgcttatatttataaaaag
atattaaaaccatctgaagaaatcactcttgttgtaaaggagataaaaaaagaaaaaaaa
gcttttaaagaagaatactttataaatttaaaaaacaaaagtcaagaagaacaaatcaaa
gaactcagtgctatagttttagatgatgaagaaaacaaaagccaatatcagttaaaactt
aaagagttaaaagaaaaagaaaaaaatatagatgttttctctaaaatgaaattccatgtt
cctttaattgctggtgttgctgctttgattatagcttctatgtttttatttaaaggcttg
aataaagtttcaacactagatgtaatgcaaaatttatggatagtttctatcatttcaatt
tttgcttatattgttaccttagcagtagtaagacttatgaaaaaaactcaagttaataaa
actatagaaaagattttttcatggtttcagatttttaccgcctcaagctttgccttttca
catggagctaatgatatagctaatgctcttgggccgtttgctgctattttagatgtgcta
aaaaataatactattaatcctagttctccagtgccatttgctgtaatgcttatgtttggt
atagctttggttattgggctttggtttttaggtaaagaagtgattcaaacggtgggttca
aaattagctgaaattaaaccaactacaggttttagtgctgagcttggtgcgagtattgtg
atacttttagcaacccagcttggaattccagttagctcaacacatattttaatcggagca
attttgggtataggggtatttaataaagatgctaaatggagtatgatgaagcctattggg
cttgcttggatcattactttaccagttgcaggaattctttcaagtattatttttatggta
tttgtaaatataatcttatga

DBGET integrated database retrieval system