KEGG   Cyclobacterium amurskyense: CA2015_0159Help
Entry
CA2015_0159       CDS       T03993                                 

Definition
(GenBank) Beta-hexosaminidase
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
camu  Cyclobacterium amurskyense
Pathway
camu00511  Other glycan degradation
camu00520  Amino sugar and nucleotide sugar metabolism
camu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:camu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CA2015_0159
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CA2015_0159
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:camu03110]
    CA2015_0159
Enzymes [BR:camu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CA2015_0159
Chaperones and folding catalysts [BR:camu03110]
 Intramolecular chaperones
  Others
   CA2015_0159
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_20 CHB_HEX_C Glyco_hydro_20b CHB_HEX_C_1 Fn3_assoc CHB_HEX
Motif
Other DBs
NCBI-ProteinID: AKP49641
UniProt: A0A0H4P5F6
Position
complement(204206..206818)
Genome map
AA seq 870 aa AA seqDB search
MNKITRIVAYLLLISCFFSCQPSTNWKEAVDSIYIDWEVKTNFTEEEGQFEASFGIENRS
QYPLGEKGWDLFFSMAPRGILSSENAKITHINGDWYKLSPIDGFALAPGESILIPYVGIE
GVIKETDAPMGMYFVFYSEDGTSEEVIPVKNLEVKPFLRDEQRLRGAMDEEAPYSAESQY
ERNENLVKLDKEELLPIIPTPFSVRKGNGQFILEEKLAIEFENGLSNEAKYLSEKLSELT
GVKFSTHEGVSNNQGIVLKLAKMEVNGKRDEAYKLDVNQNGVVLTGSDPAGVFYGVQSLL
ALLGNDAYLNQKLPLSLPYINIADSPRFGFRSLHMDVARNFQTKETIKRTLDIMSHYKLN
HFLFYTTEDEGWRLEIPGLPELTEVGGQRQHASSMDDPSVHPGYGSGPFAYMEGKNGSGF
YTKDEFVDILKYAKERHITVIPVLNFPGHARAAIKSMEKRYLDLMEEGRTEEAEAYRLVD
PEDKSQYMSAQSFKDNVVNVANASTFDFYLKVVDELTKMYAEAGLELKKMHSGGDEVAEG
AWTASPQARELLKKLPEIKDPKNLQTYFFSTLLEKLEGRDLEMHVWEEMVLLKDESGVYK
PNPAFAGKKVVPYIWNNMFDYPDLGYQLANMGYDVVLCNVSNFYFDLAYSNDPEEPGLYW
AGFVNTKNAWAFAPYDWFKTTYKTSMGRTIDRAKEFKDMVRINPDAKDHIIGLEAQLWTE
TVKGRDMAEYYMFPKMLGFAESAWAAERDWEKEPDLVKMDQNIAKGWNQFANRIGQTALA
KLSWWNGGYNYRIAPPGAKVEDGKLFANVNFPGLQIRYTTDGSEPNEESALYTGPVEIEG
EVTLKVFDETGKGSRTIKVSPKNWELRESN
NT seq 2613 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaatcactcggatcgttgcctacttacttttaataagctgctttttttcctgc
caaccctctacaaattggaaggaggctgttgattccatttatatcgattgggaagtaaaa
accaactttacggaagaagaggggcaatttgaagccagttttggaatagaaaaccgcagt
cagtatccgcttggggaaaaaggttgggacctgttttttagtatggccccaagaggaatc
ttatcgagtgaaaatgccaaaatcacccatattaatggagattggtacaagcttagccca
attgatggcttcgcgctagctccaggggagagtattttaattccttatgttgggattgaa
ggggtgataaaagaaacagatgcacctatgggtatgtattttgttttttacagtgaggat
ggaacatctgaagaagttattcccgtaaaaaacttggaggttaagccatttttaagggat
gaacaacgcctgagaggtgccatggacgaagaagctccctattctgcggaaagtcaatat
gaacgcaatgagaatttggtaaaattagataaagaagaattattgccaattatacctaca
ccatttagtgtaaggaaaggaaatggtcaatttatacttgaggaaaaacttgccatagaa
tttgaaaatggcctttccaatgaggcaaaataccttagtgagaaattaagtgaacttaca
ggagttaaattttctacacatgaaggtgtgagcaataatcaagggatagtgttgaaattg
gcgaaaatggaagtcaatggtaagcgcgatgaggcttacaaattggatgtcaatcaaaat
ggggttgtgttgacaggtagtgaccctgcaggtgttttttacggagtacaaagcttattg
gcactattaggtaatgatgcttacttgaaccagaagttaccacttagtctaccttatatt
aatatagcggattcacctcgatttggctttaggagtttacacatggatgtggctcgaaat
ttccaaacgaaagagaccattaaaaggactcttgatatcatgtctcattataagctgaat
cattttctgttttataccactgaggatgaaggatggagattggagattccaggacttcct
gaattaacagaagttggaggtcagagacaacatgctagtagtatggatgatccttctgtt
catccgggttatggctctggaccattcgcttatatggaagggaaaaatggaagtgggttt
tacacaaaagatgaatttgttgatatcctgaaatatgcgaaagaacgacacatcacagtt
attcctgtgttgaattttccaggacatgccagagcggccatcaagtccatggagaaaaga
tatttagatttaatggaagagggtagaacagaggaagctgaagcttatcgtctcgtggat
ccggaagacaagtcccaatacatgtcagcacagtcttttaaagacaatgttgtcaatgtg
gccaatgcttcaacttttgacttttacctaaaggttgttgacgaattaacaaaaatgtat
gcagaggcaggtcttgaacttaaaaaaatgcactccggaggagatgaagtagcagagggg
gcatggacagcctctcctcaggcaagagaattattgaaaaagctacccgaaatcaaagat
cccaaaaacttacaaacgtattttttcagtactttattggaaaagttggaaggtagagat
ttagaaatgcatgtttgggaagaaatggtccttcttaaagatgagtcaggagtgtataaa
cctaacccggcctttgcagggaaaaaggtcgttccttatatatggaacaatatgtttgat
tatcctgatttgggttatcagttggccaatatgggctacgatgtggtactatgtaatgtg
tccaacttttactttgatctggcctatagtaacgatcctgaggaaccaggcttgtattgg
gcaggctttgtcaataccaaaaatgcctgggcatttgcgccttatgattggtttaagaca
acttataagaccagtatgggtagaacaatagatcgtgccaaagaatttaaagacatggta
aggattaaccctgatgccaaagaccatatcataggtctagaggctcagttgtggacagaa
accgtaaaaggcagggatatggcggaatactatatgtttcctaagatgcttgggtttgca
gaaagtgcatgggcagctgagagagattgggagaaagagccggacttggttaaaatggat
cagaatattgctaagggctggaatcagtttgcaaatagaattgggcagacagcattggca
aaactgagttggtggaatgggggctataattatagaatagcacctcctggcgcaaaagtt
gaagacggtaagttgtttgccaatgtgaatttccccggcttacaaataaggtataccact
gatggaagtgagcctaatgaagagtcagcactgtatactgggccagtagaaatagaggga
gaggtaacacttaaagtgtttgatgaaactggaaaaggtagcaggacaataaaagtttct
ccaaaaaattgggagctaagagaaagtaattga

DBGET integrated database retrieval system