KEGG   Cyclobacterium amurskyense: CA2015_1014Help
Entry
CA2015_1014       CDS       T03993                                 

Definition
(GenBank) Pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
camu  Cyclobacterium amurskyense
Pathway
camu00790  Folate biosynthesis
camu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:camu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CA2015_1014
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:camu04147]
    CA2015_1014
Enzymes [BR:camu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     CA2015_1014
Exosome [BR:camu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CA2015_1014
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: AKP50468
UniProt: A0A0H4PCF3
Position
complement(1251864..1252094)
Genome map
AA seq 76 aa AA seqDB search
MWKEADNKLSRTFEFKDFSEAFAFMTRVALLAESRQHHPNWSNEYNKVHIDLTTHDEGNT
VTEKDRDLASAIDRLI
NT seq 231 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaagaagcagacaataaattatcaagaacctttgaattcaaagatttcagtgaa
gcttttgcctttatgaccagggtagccttactcgcggagtcccggcagcatcaccccaac
tggagcaatgaatacaacaaagtccatattgaccttaccacacatgacgagggaaacacc
gtgacggagaaagaccgtgatttagcttcagccatagaccgtttaatttaa

DBGET integrated database retrieval system