KEGG   Cyclobacterium amurskyense: CA2015_2711Help
Entry
CA2015_2711       CDS       T03993                                 

Definition
(GenBank) Aminomethyltransferase
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
camu  Cyclobacterium amurskyense
Pathway
camu00260  Glycine, serine and threonine metabolism
camu00630  Glyoxylate and dicarboxylate metabolism
camu00670  One carbon pool by folate
camu01100  Metabolic pathways
camu01110  Biosynthesis of secondary metabolites
camu01130  Biosynthesis of antibiotics
camu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:camu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CA2015_2711
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CA2015_2711
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    CA2015_2711
Enzymes [BR:camu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     CA2015_2711
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C SoxG
Motif
Other DBs
NCBI-ProteinID: AKP52121
UniProt: A0A0H4PCF1
Position
complement(3263045..3264136)
Genome map
AA seq 363 aa AA seqDB search
MEKIKKVTLDEIHHSLGAKMIPFAGYDMPVRYSSDMEEHKTVRENVGVFDVSHMGEFIVQ
GPNALDLIQKVSSNDAAKLKIGQAQYTCFPNLEGGVVDDFLVYKIEEERYMLVVNASNID
KDWAWIQQHNTVNAKLENISDEISLFAIQGPNTIKAIQSLTSTSLKDIPFYHFEVGSFAG
VDDVIISATGYTGEPGFELYVKNADAKKIWNAIFDSGSQLDIKPIGLGARDTLRLEMGYC
LYGHELSDTTSPLEAGLGWITKFTKDFINHEALKKQKEAGIKRKLVGFKLLERGIPRADY
SIVNAEGEVIGKVTSGSQSPSMGIGIGLGYVDIEYAKPGTEIGIEVRKKRISAKIEKLPL
LKK
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaataaaaaaggtaactctagatgaaatacatcattcattaggtgcaaaaatg
atcccatttgcagggtatgacatgcctgtaaggtacagctccgatatggaggaacacaaa
acagttcgagaaaacgtgggtgtttttgatgtttcccatatgggtgaatttatagtacag
ggacccaatgctcttgacttaatacaaaaagtctcctcaaatgatgccgcaaagcttaaa
ataggacaagcacaatacacttgctttcccaatcttgagggcggagttgttgatgatttt
ttggtttataaaatagaagaagagcgctacatgcttgtagtgaacgcatccaatatcgat
aaagactgggcatggatacagcaacataacactgtaaatgcaaaactggaaaacatatca
gatgaaatttccttatttgccattcaagggccgaatacaataaaagccatacaatcacta
acttcaacttcattaaaagatattccattttatcattttgaagtaggctcttttgcaggt
gtagacgatgtaatcatttctgctactggctatacaggtgaaccaggctttgaattgtat
gtgaaaaatgccgatgcaaagaaaatatggaatgccattttcgattcaggtagccaactg
gatataaaaccaataggattgggagccagggacaccctacgcttagaaatgggatattgc
ctttatggccatgaactttcagataccacctccccattagaggcgggattaggctggatt
accaaattcaccaaagacttcattaatcatgaggcgctgaaaaagcagaaagaagcaggt
atcaaaagaaaactagtaggttttaaacttttagaaagaggaattccaagagcagattat
tccattgtaaatgcagaaggtgaagttataggaaaagtcacttctggaagtcaatcacca
agcatgggtattggtattggtttaggttatgtagacattgaatacgccaaacctggaacc
gagatcgggattgaggtaaggaaaaaaagaatttctgccaaaatagagaaactacccctg
cttaaaaaatga

DBGET integrated database retrieval system