KEGG   Cyclobacterium amurskyense: CA2015_4511Help
Entry
CA2015_4511       CDS       T03993                                 

Definition
(GenBank) Alkaline phosphatase D-related protein
  KO
K01113  alkaline phosphatase D [EC:3.1.3.1]
Organism
camu  Cyclobacterium amurskyense
Pathway
camu00790  Folate biosynthesis
camu01100  Metabolic pathways
camu02020  Two-component system
Module
camu_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:camu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CA2015_4511
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CA2015_4511
Enzymes [BR:camu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     CA2015_4511
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhoD Metallophos PhoD_N fn3 FAINT
Motif
Other DBs
NCBI-ProteinID: AKP53849
UniProt: A0A0H4PI71
Position
complement(5611051..5612532)
Genome map
AA seq 493 aa AA seqDB search
MEVKVSKRRSFLGKFSFFLISFFVGRVKPLLAMKNLFGLPKNTGKLYFPNGFKVTEVSTT
EAVVWTRLSHSKKPKPIIHKKAKTKPKANNYYPVDFDENQPVKNMDGAIVGAKGKVRIKY
KAKGKTVETDWYKTESINDFTAQIPLTNLKSGEHYSFELEAMPADGQVHSSVSGSFNTAS
DPTEIKSVNLTTSTCQYFWNYDDAKRGFKTYDAMTKLKPDFFVHTGDYVYYDRIGPLATD
IEKARHKWHAMDGWASIKEFYQQVPIYMLKDDHDLLKDDVYPDSSPLGELTLENGLKIWR
ENVPLKDKPYRTFRWGKDLQIWLVEGREYRSPKDISAGQPRTIWGEEQKNWFIETFEKSD
ATFKILFSPTPVVGPDREKKRDNHANQLFEKEGNWIRGFLSDKKGVFVVNGDRHWQYYSI
DEATGLREFGAGPVSDSQSGGWSQDDKRPEHQFLRVKGGFLGIKVFRNGSVPKIDFRHYD
VEGRIVNKVEFDS
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggaagtgaaagtgtccaaaagaagatcctttttaggaaagtttagtttctttttaatt
tcattttttgtggggagggtgaaacccttgttggccatgaaaaatctctttggcttgcct
aagaacaccggaaagttgtatttcccgaatggctttaaagtaaccgaagtatctacaact
gaggcagtcgtatggaccaggcttagtcatagtaaaaagcctaaaccgattattcataaa
aaggccaaaacaaagcctaaagccaacaattattacccggtagattttgatgaaaatcag
ccggtgaaaaatatggatggtgccattgttggggctaaaggaaaagttagaattaaatac
aaggcaaaggggaaaactgtagaaacagattggtataaaactgaatcgatcaatgatttt
actgcccaaatacctttgacaaatctaaaatcaggtgaacattattcctttgaattggag
gccatgccagcggatggacaggttcattcatctgtgtcaggtagttttaatactgcttct
gacccaacggagattaagtcggtaaacttaaccacttccacctgccaatacttctggaat
tatgatgatgccaagcggggtttcaaaacttatgatgcaatgacaaaattaaagcccgat
tttttcgtacatacaggagattatgtgtattatgacaggattgggccattggccactgat
atagaaaaggccagacataagtggcatgctatggatggttgggcttctattaaggaattc
tatcaacaagtgccaatttatatgcttaaggatgatcatgatttgcttaaggatgatgta
tatccggattccagtcccttgggtgagttaactttggaaaatggcttaaagatttggcga
gaaaatgttcccttaaaagacaaaccttacaggacttttagatggggaaaagatttacag
atttggcttgtggaggggagggaataccgaagtcctaaagacatatccgcaggccagccc
agaacgatttggggtgaagagcaaaagaattggttcatagaaacctttgaaaaatcagat
gccacttttaaaatcttgttttctcccacccccgtagttggtccggatagagagaaaaaa
cgagacaaccatgccaatcaattgtttgaaaaagaaggaaattggataagaggatttttg
tccgataaaaagggggtttttgtagtcaatggagacaggcattggcagtattattctata
gatgaagcaacaggtttgagagagtttggtgcaggtcccgtatcagattcccaatccgga
ggctggtctcaagatgataaacgaccagaacatcaatttttgagggtaaagggcgggttt
ttgggaataaaagtattccgaaatggctctgttcccaaaattgacttcaggcattatgat
gtagaaggaagaatagtgaataaagtagaatttgatagttga

DBGET integrated database retrieval system