KEGG   Campylobacter sp. RM6137: CSUIS_0330Help
Entry
CSUIS_0330        CDS       T05900                                 

Gene name
mqo
Definition
(GenBank) malate:quinone-oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
camy  Campylobacter sp. RM6137
Pathway
camy00020  Citrate cycle (TCA cycle)
camy00620  Pyruvate metabolism
camy01100  Metabolic pathways
camy01110  Biosynthesis of secondary metabolites
camy01120  Microbial metabolism in diverse environments
camy01130  Biosynthesis of antibiotics
camy01200  Carbon metabolism
Module
camy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
camy_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:camy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CSUIS_0330 (mqo)
   00620 Pyruvate metabolism
    CSUIS_0330 (mqo)
Enzymes [BR:camy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     CSUIS_0330 (mqo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO NAD_binding_9 Pyr_redox_2 Amino_oxidase NAD_binding_8 Pyr_redox_3 Spermine_synth Lycopene_cycl K_oxygenase
Motif
Other DBs
NCBI-ProteinID: ARR00171
UniProt: A0A1X9SVB4
Position
334417..335763
Genome map
AA seq 448 aa AA seqDB search
MKEKHYEVVIIGGGISGGALLYELARYTDVKSIALIEKYGGLATLNSKGTANSQTIHCGD
IETNYTFEKAQKVSKTARMVVKYGLQHGYQGKYMFDGQKMAIGVGDVEVDYIKNRFNEFK
ELYPYLEFYDKAELAKIEPKIILNSDGTHRAENVVGMGVKSGEYTTVDYGAFTTTFVENA
KKEGGECDVYLNSKVDIITQNADKYYIQTANGLSISADFVVVNAGAHSLYLAHKMGYGLD
FGCLPVAGSFYLTKKKLLNGKVYMVQNPKLPFAALHGDPDILADGCTRFGPTALALPKLE
RYHDNWGSFLDFCKTLNFDSAIAGILFDLFKDSEIRNYILRNFLFEVPYLNKKLFVKDAQ
KIVPSLSTNDIYYAKGFGGVRPQVLNKTEKKLMLGEASINPKTGIIFNMTPSPGATSCLG
NALRDVREVCEYLGKNFNEAKLNEELFD
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagaagcactatgaggtggtgataattggtggcggtatcagtggcggtgcgcta
ctatatgaattggctagatatacagatgttaaaagtattgcattaatagaaaaatatggc
ggtttagctacgctaaattcgaaaggaacggctaattctcaaactatccattgtggcgat
attgagacaaactatacatttgaaaaggctcaaaaagtcagcaaaactgctagaatggtg
gtaaaatatggcttacagcacggctatcaaggcaaatatatgtttgatggtcaaaaaatg
gcaattggcgtaggcgatgttgaggttgattatattaaaaatagatttaatgaatttaaa
gagctttatccatacttggagttttatgataaggctgaactagctaaaatcgagccaaaa
attatattaaatagcgatggtactcatagggctgaaaatgtggttggtatgggtgttaaa
agtggtgaatataccaccgttgattatggtgcatttacaactacatttgtagaaaatgct
aaaaaagagggcggagagtgtgatgtatatctaaactcaaaagtggatataatcactcaa
aatgcagataaatactatatccaaactgcaaatggtctatcaattagtgctgattttgtc
gtagtaaatgctggtgctcactctttatatttagctcacaaaatgggatatgggcttgat
tttggttgtttgcctgtggctgggagcttttatttaactaagaaaaaactattaaatggc
aaggtttatatggtacaaaatcctaaattaccttttgctgctttacatggcgatccagat
attttagctgatggttgtactagatttggccctactgctttagcacttcctaaactagag
agataccatgataattggggaagtttccttgatttttgtaaaactttaaattttgattca
gccattgctggtatattatttgatctatttaaagatagcgaaattcgcaactatatttta
cgcaatttcttatttgaagttccatatctaaacaaaaaattatttgtcaaagatgctcaa
aaaattgtcccaagcctaagtactaacgatatttattatgctaaaggttttggcggtgtt
cgccctcaagtattaaataaaacggagaaaaaattaatgttaggtgaagctagtataaat
ccaaaaaccggaataatctttaatatgacaccaagccctggtgcgacaagctgccttggc
aatgcgttaagagatgttcgtgaagtttgtgaatatctaggcaaaaacttcaacgaagcc
aaattaaacgaagagttatttgattaa

DBGET integrated database retrieval system