KEGG   Campylobacter sp. RM6137: CSUIS_1003Help
Entry
CSUIS_1003        CDS       T05900                                 

Gene name
metS
Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
camy  Campylobacter sp. RM6137
Pathway
camy00450  Selenocompound metabolism
camy00970  Aminoacyl-tRNA biosynthesis
camy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:camy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CSUIS_1003 (metS)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CSUIS_1003 (metS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:camy01007]
    CSUIS_1003 (metS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:camy03016]
    CSUIS_1003 (metS)
Enzymes [BR:camy01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     CSUIS_1003 (metS)
Amino acid related enzymes [BR:camy01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CSUIS_1003 (metS)
Transfer RNA biogenesis [BR:camy03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CSUIS_1003 (metS)
 Prokaryotic type
   Other AARSs
    CSUIS_1003 (metS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e tRNA-synt_1f Zn-ribbon_8
Motif
Other DBs
NCBI-ProteinID: ARR00816
UniProt: A0A1X9SX86
Position
complement(986863..988755)
Genome map
AA seq 630 aa AA seqDB search
MKKFITTPIYYVNDVPHIGHAYTTIICDTLARFYRLRGDDVFFLTGTDEHGQKIEEAAKA
RGKSPKEYADEVSAKFRALWDEFGISYDYFIRTTDDYHKITSQNVFSKMLKKGDIYKGEY
EGSYCVSCESFFATNQLIDDECCPDCGKKTRLVKEESYFFALSKYQDRLLKWYEDDKCVL
PKGKKNEVISFVKGGLKDLSITRTSFEWGIKLPKELNEPKHVMYVWLDALVNYLSALGYT
RGEEKMEYWGNTLHMVGKDILRFHAVYWPAFLMSLDLPMPVSVAAHGWWTRDGVKMSKSL
GNVVNPKEVADAYGLEAFRYFLLREVPFGQDGDFSQKALIDRINSELSNDLGNLLSRIVG
MSSKYSDNIINSADVKKFYLSELEAAKIHIDQAVASLDEIAPNRYLEELWKVLNMANALV
AKYEPWNLIKNNKFDEANALVALVANLLAKVAILLSPAMPNTAQKIADTLEFKIDTNSYN
ELIINSNLSNFKANSTTPLFAKIEHELMSPAPVAKIGEAKSKDEEIKIDDFKKCVIKVGT
ILECDNIEGSDKLLKFKIDLGEENPRQIISGIAKYYEPKSLIGKQVCVLANLKPAKIFKH
LSEGMILSAEDGSLTLLGTHANVKNGAIVG
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaatttataaccacaccaatatattatgtaaatgatgtcccgcatatcggacac
gcttatactacgataatttgcgataccttagctagattttatcgcttaaggggcgatgat
gtcttttttttaacaggcacagatgagcatggccaaaagatagaagaggctgccaaagct
agaggtaaaagcccaaaagagtacgcagatgaggtaagtgctaaatttagggctttatgg
gatgaatttggcattagctatgattattttatccgcactactgatgattatcataagata
actagccaaaatgttttttctaaaatgcttaaaaaaggggatatttataaaggggagtat
gaaggtagctactgcgtaagctgtgagagtttctttgctactaatcaactaatagatgat
gagtgctgtcctgattgtggtaaaaagactaggttggtaaaagaagagagctactttttt
gctctttcaaaatatcaagatagattattaaaatggtatgaagatgataaatgcgtcctt
ccaaaaggcaaaaaaaatgaggtaataagctttgtcaaaggcggacttaaggatttatct
attactaggactagctttgagtgggggattaaactaccaaaagagctaaatgagccaaag
catgtaatgtatgtgtggctagatgcgctagttaattatctctcagccttaggatatact
aggggtgaggagaagatggagtattggggaaataccttgcatatggttggtaaggatatt
ttgcgttttcatgcggtttattggccggcgtttttgatgagtcttgatctgcctatgcca
gttagcgtagcagcacatggctggtggactagagatggggttaagatgagtaagagtctt
ggcaatgtcgtaaatccaaaagaggtagccgatgcgtatggtctagaggcgtttagatat
tttctattaagagaggtgccatttggtcaagatggggatttttctcaaaaggctttaata
gatcgcataaatagcgaattaagcaatgatttaggcaatttattaagtagaatagtaggt
atgagctccaaatattcagataatattattaattcagctgatgttaagaaattctattta
agtgagcttgaagcggctaaaatacatatagatcaagcagttgctagtctagatgagatc
gctccaaatagatatttagaagagctttggaaagttttaaatatggcaaatgctttagtg
gctaagtatgagccttggaatttgattaagaataataaatttgatgaggcaaatgccttg
gtggccttggtggcaaatcttttggctaaggttgctattttgctaagtccagcaatgcca
aatacagctcaaaaaatagctgatactttggagtttaaaattgatactaatagctataat
gagcttataataaactcaaatttaagcaattttaaagctaactctaccactcctttattt
gctaaaatagagcatgaattaatgtctccagccccagtggcaaagattggtgaggctaaa
tctaaagatgaagagattaaaatagatgattttaaaaagtgcgttatcaaagttggcact
attttagagtgtgataatatcgaaggtagtgataaattgcttaaatttaaaattgattta
ggcgaggaaaatccaaggcaaattatcagcggtatagcaaaatattatgagccaaaaagc
ttaataggcaagcaagtttgcgtcttggctaatttaaaaccagctaagatatttaagcat
ttaagcgagggtatgatactgagcgcagaagatggaagcttaactcttttaggcactcat
gctaatgtaaaaaatggagcgattgtcggataa

DBGET integrated database retrieval system