KEGG   Campylobacter sp. RM12175: CVIC12175_0111Help
Entry
CVIC12175_0111    CDS       T05727                                 

Gene name
ubiX
Definition
(GenBank) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
camz  Campylobacter sp. RM12175
Pathway
camz00130  Ubiquinone and other terpenoid-quinone biosynthesis
camz01100  Metabolic pathways
camz01110  Biosynthesis of secondary metabolites
camz01120  Microbial metabolism in diverse environments
camz01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:camz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    CVIC12175_0111 (ubiX)
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    CVIC12175_0111 (ubiX)
Enzymes [BR:camz01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     CVIC12175_0111 (ubiX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein DUF1660
Motif
Other DBs
NCBI-ProteinID: ARR03277
Position
complement(98084..98629)
Genome map
AA seq 181 aa AA seqDB search
MKLIVAISGASGAHLGIKLANTTASLNINTSLIITQNAKLSMQKESLSIEINKQIQIYDI
DDISAAPASGSAMYDAMIVAPCSINTLAKISCGIGDNLLLRAAAVMIKERRNLILAVRET
PLSAISLRQMADLAALGVGIAPPILGYYTQPSSIDEAENFIIAKWLDSLKIKHNLIRRWN
G
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
gtgaagctaatagtagcaatcagcggagctagcggggctcatcttggtatcaaactagct
aatactacagcaagtctaaatatcaataccagcctaatcatcacccaaaatgccaaacta
tcgatgcaaaaagagagtctaagcatagagataaataagcaaattcaaatttatgatata
gatgatattagcgcagctccagctagtggttcagctatgtatgatgctatgatagtagca
ccttgttctattaatactttggctaagattagttgcggaattggtgataatctactctta
agagcagctgcagtaatgataaaagaaagaagaaatctaatcttagccgtaagagaaacc
cctttaagtgctatttcactgcgtcaaatggcagatcttgcagctcttggagtaggaatt
gcgcctccaattttaggatactatacacagcctagtagcattgatgaggctgaaaatttc
ataatagccaaatggctagatagtctaaaaataaagcacaatctaataaggcgatggaat
ggataa

DBGET integrated database retrieval system