KEGG   Campylobacter sp. RM12175: CVIC12175_0889Help
Entry
CVIC12175_0889    CDS       T05727                                 

Definition
(GenBank) short-chain dehydrogenase/reductase
  KO
K00076  7-alpha-hydroxysteroid dehydrogenase [EC:1.1.1.159]
Organism
camz  Campylobacter sp. RM12175
Pathway
camz00121  Secondary bile acid biosynthesis
Brite
KEGG Orthology (KO) [BR:camz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00121 Secondary bile acid biosynthesis
    CVIC12175_0889
Enzymes [BR:camz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.159  7alpha-hydroxysteroid dehydrogenase
     CVIC12175_0889
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR DUF3573
Motif
Other DBs
NCBI-ProteinID: ARR04016
Position
851654..852442
Genome map
AA seq 262 aa AA seqDB search
MNCYHEEFKGKTLVISGGTRGIGRAIVLEFAKYGANIAFTYNSNEEMAKNQALELEKEFG
IKARAYPLNILEPETYKELFLEIDKDFDRVDFFVSNAIISGRAVAGGYTKFMKLKPRGIN
NIFTATVNAFVVGSQEAAKRMEKVGGGSIVSLSSTGNLVYIEHYSGHGTAKAAVEAMARY
AATELGEKNIRVNVVSGGPIETDALRAFTNYEEVRDATASLSPLGRMGQPTDLAGACLFL
CSSKASWVTGHTFIIDGGTTFK
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaactgttatcatgaagaatttaaaggcaaaaccttagttattagtggcggtacaaga
ggaattggtagagcaattgtacttgaatttgcaaaatatggtgcaaatattgcatttacc
tataactctaatgaagagatggctaaaaatcaagcattagaattagaaaaagaatttggt
attaaagctagagcatatcctttaaatattcttgagcctgaaacttataaagagctattt
ttagagatagataaagattttgatagagtcgatttttttgtatcaaatgcaattatttca
ggacgcgcagtagctggtggttatactaaatttatgaagttaaaacctcgtggaataaac
aatatctttactgcaactgtaaatgcatttgtagtaggctctcaagaagctgctaaaaga
atggaaaaagtaggcggtggtagcatagttagcttaagctcaaccggaaacctagtctat
atagaacactatagcggtcacggcacagcaaaagctgcagtagaagctatggcaagatac
gcagctactgagcttggcgagaaaaatattagagtaaatgtagtaagtggcggaccaata
gaaactgacgccttaagagcatttacaaactatgaagaggtaagagatgctacggcttca
ctaagtcctttaggtcgcatgggacaaccaactgatcttgctggtgcttgtttatttcta
tgcagctcaaaagctagctgggtaacaggccatacatttataatagatggtggcactact
tttaaatga

DBGET integrated database retrieval system