KEGG   Campylobacter sp. RM12175: CVIC12175_1079Help
Entry
CVIC12175_1079    CDS       T05727                                 

Gene name
pckA
Definition
(GenBank) phosphoenolpyruvate carboxykinase (ATP)
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
camz  Campylobacter sp. RM12175
Pathway
camz00010  Glycolysis / Gluconeogenesis
camz00020  Citrate cycle (TCA cycle)
camz00620  Pyruvate metabolism
camz01100  Metabolic pathways
camz01110  Biosynthesis of secondary metabolites
camz01120  Microbial metabolism in diverse environments
camz01130  Biosynthesis of antibiotics
camz01200  Carbon metabolism
Module
camz_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:camz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CVIC12175_1079 (pckA)
   00020 Citrate cycle (TCA cycle)
    CVIC12175_1079 (pckA)
   00620 Pyruvate metabolism
    CVIC12175_1079 (pckA)
Enzymes [BR:camz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     CVIC12175_1079 (pckA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP
Motif
Other DBs
NCBI-ProteinID: ARR04197
Position
1046667..1048244
Genome map
AA seq 525 aa AA seqDB search
MIKDLDKLGLSDIKEIYHNLSYDELFAHEKANNEGYVTNNGTFSVDTGIFTGRSPKDKYF
VNQDPSNKYLAWGKVNQPMTKETFDKLLAKAKSQLSGKNIYIQDAYCGSSLASRKSVRFV
TEVAWQAHFVKNMFIRPTQSELADFTPDFVVYNACKCVNDEYKKDGLNSEVFVIFNIEEN
IAVIGGTWYGGEMKKGIFSMMNYWLPLENKLSMHCSANVGKDGDTALFFGLSGTGKTTLS
TDPNRALIGDDEHGWDDEGVFNFEGGCYAKCINLDPKSEPEIYAAIKRNALLENVCIDQN
GIVDYSDDSKTENTRVSYPIEHIPNHEPSLKAGHPRNIIFLTADAFGVLPPVSKLTKEQA
MYYFLSGYTAKVAGTERGITEPQATFSACFGEPFMPLHPTVYARLLGEKIDKHEVNVYLV
NTGWSGGAYGVGKRMSIKATRACINAILDGSIQKCEFENFEKFNLAIPKSLDGVETNLLN
PINTWADKNEYIAARDNLANMFINNFKRYEDVAEGIQFAKAGPIS
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgataaaggatttagataagctaggcttaagtgatatcaaagagatttatcataatcta
agctatgatgagctttttgctcatgagaaagcaaataatgaaggttatgtcacaaacaat
ggaacctttagtgtagatactggaattttcacaggtcgcagtcctaaagataagtatttt
gtaaatcaagatccaagtaataaatatctagcttggggtaaagtcaatcaacctatgaca
aaagagacatttgataaactccttgctaaagcaaaatctcaactaagtggtaaaaatatc
tatatccaagatgcatattgtggctccagcctagcaagtcgcaaaagcgtaagatttgtt
acagaagtagcgtggcaagcacactttgtaaaaaatatgtttatccgtccaactcaatct
gaactagctgattttactcctgattttgtagtatataatgcttgtaaatgcgtaaatgat
gagtataaaaaagatggattaaactcagaagtattcgtaatatttaatatagaagagaat
atcgcagtaataggtggcacatggtatggtggcgagatgaaaaagggaatattttctatg
atgaactactggctaccactagaaaataaactatctatgcactgtagtgcaaatgtagga
aaagatggtgatacagccctattttttggactaagtggaacaggtaaaacaactctatca
actgatccaaatagagctttaatcggtgatgatgagcatggatgggatgatgaaggagta
tttaactttgaaggtggatgctatgcaaaatgtatcaacctagatcctaaaagcgaacct
gaaatttatgctgctatcaaacgcaatgcactattagaaaatgtctgtattgatcaaaat
ggcatagtagattatagtgatgattcaaaaacagaaaatactcgtgtaagctatccaata
gaacatattccaaatcatgaaccaagcctaaaagctggacacccaagaaatattatattc
cttacagctgatgcgtttggcgtacttcctccagtatcaaaacttacaaaagaacaagct
atgtattacttcttaagtggctatacagcaaaagttgctggtactgaacgcggtattaca
gagcctcaagctacattttcagcatgctttggagaaccatttatgccgcttcatccaaca
gtatatgcaagactattaggcgaaaaaatagataaacatgaagtaaatgtatatctagta
aatactggctggagcggcggtgcttatggcgtcggtaaaagaatgagtataaaagctact
agagcttgtataaatgctattttagatggtagtattcaaaaatgtgaatttgaaaatttt
gaaaagttcaatctagctataccaaaatctcttgatggtgttgaaacaaatttattaaat
cctattaatacatgggctgataaaaatgaatatatcgctgcaagagacaacctagctaat
atgtttattaacaacttcaaacgctatgaagatgtagctgagggaatacaatttgccaaa
gctggtccaataagctaa

DBGET integrated database retrieval system