KEGG   Campylobacter sp. RM12175: CVIC12175_1376Help
Entry
CVIC12175_1376    CDS       T05727                                 

Gene name
ndk
Definition
(GenBank) nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
camz  Campylobacter sp. RM12175
Pathway
camz00230  Purine metabolism
camz00240  Pyrimidine metabolism
camz01100  Metabolic pathways
camz01110  Biosynthesis of secondary metabolites
Module
camz_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
camz_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
camz_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:camz00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CVIC12175_1376 (ndk)
   00240 Pyrimidine metabolism
    CVIC12175_1376 (ndk)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:camz04131]
    CVIC12175_1376 (ndk)
Enzymes [BR:camz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     CVIC12175_1376 (ndk)
Membrane trafficking [BR:camz04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    CVIC12175_1376 (ndk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: ARR04478
Position
complement(1330683..1331096)
Genome map
AA seq 137 aa AA seqDB search
MEQTLSIIKPDATKKGVIGKIIDRFESNGLRIAAAKKVQLSVEDAKKFYEVHAQRPFYND
LVEFMTSGPVVVMVLEGKNAVLKNRELMGATNPKEAAPGTIRADFAESIDANAVHGSDSL
ENAKIEIAFFFASREIC
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaacgctatcaataatcaaacctgacgcaactaaaaagggcgtaattggcaaa
attatagatagattcgaaagcaacggacttagaatcgcagcagctaaaaaagtacaatta
agcgtagaagatgctaagaaattttatgaagtacatgctcaaagaccattttataatgat
ttagttgagtttatgactagcggaccagtagtagtaatggttctagaaggtaaaaacgct
gtacttaaaaatagagaattaatgggtgctacaaatcctaaagaggctgcacctggcact
attagagctgattttgctgagagtattgatgcaaatgcagttcacggtagcgatagtcta
gaaaatgctaagatagaaattgcatttttctttgctagtagagagatctgctaa

DBGET integrated database retrieval system