KEGG   Campylobacter sp. RM12175: CVIC12175_1405Help
Entry
CVIC12175_1405    CDS       T05727                                 

Gene name
gltX2
Definition
(GenBank) glutamyl-tRNA synthetase
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
camz  Campylobacter sp. RM12175
Pathway
camz00860  Porphyrin and chlorophyll metabolism
camz00970  Aminoacyl-tRNA biosynthesis
camz01100  Metabolic pathways
camz01110  Biosynthesis of secondary metabolites
camz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:camz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CVIC12175_1405 (gltX2)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CVIC12175_1405 (gltX2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:camz01007]
    CVIC12175_1405 (gltX2)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:camz03016]
    CVIC12175_1405 (gltX2)
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:camz02048]
    CVIC12175_1405 (gltX2)
Enzymes [BR:camz01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     CVIC12175_1405 (gltX2)
Amino acid related enzymes [BR:camz01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   CVIC12175_1405 (gltX2)
Transfer RNA biogenesis [BR:camz03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CVIC12175_1405 (gltX2)
 Prokaryotic type
   Other AARSs
    CVIC12175_1405 (gltX2)
Prokaryotic defense system [BR:camz02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    CVIC12175_1405 (gltX2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c Elf1
Motif
Other DBs
NCBI-ProteinID: ARR04507
Position
1355407..1356786
Genome map
AA seq 459 aa AA seqDB search
MLTTRFAPSPTGFLHIGGLRTALYSYLYARKNGGKFLLRIEDTDLKRNSQEATIAIREAF
NWCGLDYDGEVEYQSKRFDIYKKYIDQLLKDGKAYKCYTTQEELAQMRAQAEANKQRPKY
DGRYRDFNGTPPEGIEPVIRIKAPLDGVIEFTDGVKGYIKFNCEDILDDFIIARSDGSPT
YNFCVVIDDALMGISHVIRGDDHLSNTPKQIILYEALGFKIPQFFHVAMINGSDGAKLSK
RHGATDVMEYKNMGYLPEALLNFLVRLGWSHGDDEIFSMHQMLELFDPYNLSKSASTYNP
SKLEWLNAHYIKTLPFERLADDMLYFGLDFRAINKGQMLLDLLRERSKTLLELKASALAI
INQPTDYDQNAVKKFINNDNKLLLSEFANSLGNANMDAKAVEEMTNEFLTQKGKKLKDLA
QPIRIAITGSAVSPSIFEVIEFIGLDELKSRIQNFLKSL
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgctaactacaagatttgctccatctccaactggatttttacacattggtgggcttaga
actgcactatatagctatctttatgctcgcaaaaatggcggtaaatttctacttcgaata
gaagataccgatcttaaaagaaactcacaagaggctacaattgctattagagaagccttt
aattggtgtgggttggattatgatggtgaagtagagtatcaatcaaaaagatttgatatt
tataaaaaatatattgatcaactactaaaagatggcaaagcctataagtgctacactact
caagaagagctagctcaaatgagagctcaagctgaagccaataagcaaaggccaaaatat
gatggcagatatagagattttaatggcacaccaccagagggtatagaaccagtaattcgt
ataaaagctccgcttgatggagtaattgaatttacagatggagtaaaagggtatattaaa
tttaactgcgaggatatcttagatgattttatcatcgctagaagcgatggaagtccgaca
tataacttttgcgttgttatagatgatgctcttatgggtatatcacatgtcattagaggt
gatgatcacctaagcaacacgccaaaacagattatattatatgaagcacttggatttaaa
ataccacaattttttcatgtagctatgatcaatggaagcgatggagcaaaactaagcaaa
cgccatggagcaacagatgtaatggagtataaaaatatgggctatctacctgaggcatta
ctaaatttcttagtgcgtcttggttggagccatggagatgatgagatatttagtatgcat
caaatgttagagctatttgatccatataatttaagcaaatcagcctctacatataatcca
tcaaaactagaatggctaaatgctcactacataaaaactttaccatttgaaagattagct
gatgatatgctatattttggattagattttagagcaataaataaaggccaaatgctacta
gatctattaagagagcgttcaaaaactctcttagaactaaaagcttcggctcttgctatc
atcaatcaaccaacagattatgaccaaaatgctgtgaaaaaatttataaataatgataat
aagctacttttaagcgaatttgccaactctcttggtaatgccaatatggacgctaaggca
gttgaggagatgacaaatgaatttctaactcaaaaaggcaaaaagctaaaagatctagcc
cagccgattagaatagcaattacaggcagcgcagtaagtcctagtatctttgaagttata
gaatttatcggtcttgatgagttaaaatcaagaatccaaaacttcctaaaatctttataa

DBGET integrated database retrieval system