KEGG   Campylobacter sp. RM12175: CVIC12175_1433Help
Entry
CVIC12175_1433    CDS       T05727                                 

Gene name
lspA
Definition
(GenBank) prolipoprotein signal peptidase II
  KO
K03101  signal peptidase II [EC:3.4.23.36]
Organism
camz  Campylobacter sp. RM12175
Pathway
camz03060  Protein export
Brite
KEGG Orthology (KO) [BR:camz00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    CVIC12175_1433 (lspA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:camz01002]
    CVIC12175_1433 (lspA)
Enzymes [BR:camz01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.36  signal peptidase II
     CVIC12175_1433 (lspA)
Peptidases and inhibitors [BR:camz01002]
 Aspartic peptidases
  Family A8: signal peptidase II family
   CVIC12175_1433 (lspA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_A8
Motif
Other DBs
NCBI-ProteinID: ARR04535
Position
1383971..1384417
Genome map
AA seq 148 aa AA seqDB search
MSRVILRFLSYFAVVFAIDQLIKWVFLHGFRYHGSFVDLILVYNKGVAFSMLSFLGANLK
YLQLGLIALLLGYLLGQKELLRSHTAAFGLILGGGCSNILDRFIHPGVVDYIFWHKWFEF
AVFNFADIMINLGVAIILIQALILRKKK
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgagtagagtaattttacgatttttaagctattttgctgtagtttttgctattgatcag
cttatcaaatgggtctttttgcacggttttagataccatggtagttttgtcgatttaata
cttgtatataataaaggtgtagcattttctatgctatcgtttttaggagcgaatttaaaa
tatctccagctaggattgattgcacttttgcttggatatttattagggcaaaaggagctt
ttaagatcgcatacagctgcatttggtttgattttaggtggaggatgttctaatatttta
gatagattcatccatcctggtgtagtagattatatattttggcataagtggtttgagttt
gctgtgtttaactttgctgatattatgataaatttaggcgtagctataatcttaatccaa
gctctaattttaagaaagaaaaaataa

DBGET integrated database retrieval system