KEGG   Cyanobacterium aponinum: Cyan10605_0969Help
Entry
Cyan10605_0969    CDS       T02376                                 

Definition
(GenBank) Mannose-1-phosphate guanylyltransferase, Phosphoglucosamine mutase
  KO
K16881  mannose-1-phosphate guanylyltransferase / phosphomannomutase [EC:2.7.7.13 5.4.2.8]
Organism
can  Cyanobacterium aponinum
Pathway
can00051  Fructose and mannose metabolism
can00520  Amino sugar and nucleotide sugar metabolism
can01100  Metabolic pathways
can01110  Biosynthesis of secondary metabolites
can01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:can00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Cyan10605_0969
   00520 Amino sugar and nucleotide sugar metabolism
    Cyan10605_0969
Enzymes [BR:can01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     Cyan10605_0969
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.8  phosphomannomutase
     Cyan10605_0969
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase PGM_PMM_I Hexapep PGM_PMM_II PGM_PMM_III NTP_transf_3 Hexapep_2 DUF4954
Motif
Other DBs
NCBI-ProteinID: AFZ53099
UniProt: K9Z1R3
Position
complement(1170802..1173315)
Genome map
AA seq 837 aa AA seqDB search
MRAVLMAGGSGTRLRPLTCNLPKPMVPVLNRPIAEHIINLLKRHGIHEIIATLHYLPDVM
RDYFQDGRDFGVTLNYAVEEEQPLGTAGCVKNIEEMLDDTFLVISGDSIADFNLQDAIAF
HRAKKSKATLILTRVPNPLEFGVVITDQENRIQRFLEKPSASEIFSDTVNTGTYILEPEV
LKYLPQDEECDFSKDLFPQLLEMEEPMYGYIADAYWCDVGHLEAYREAHYSALEKEVELQ
FPYREIDQGVWIGENTYIHPTAIVESPVLIGSNCRIGERAKILAGTIIGDNVTIGDDAEL
HRPIIWNGVIVGEESSLSACIIARGTRIDRRSQILEGAVIGSLCNIGEESQINIGVRVWP
NKRIEPGAMLNINLIWGNIAHSNLFGQRGVTGLANIDITPEFAVKLGAAYGSTLKSGSSV
VVSRDQRTVSRMVSRSLIAGLMSVGIDVQNLEAAAIPISRTMTPKLGVAGGIHVRLHPDR
HDYMLIEFFDTNGINISKAKEKKIEGAYFKEDLRRVQAIDIGDMSYPAQVVDTYRKTFET
QLNLEAIRNSDTKIVIDYVYSVSGAILPQLLAKFGCDAVVLNASLRQRAISNIERENLLS
QLGHVVEALKANFGVQVSANGELLILVDESGIQIRGEELTALMVNTILTAHPRGTVVVPM
NTSSAVEQIARRHDGKVIRTKVNPSALMETSQNTPNVVLGGSGDMGFIFPKLHPGFDAMF
TIAKLIEMLTVQERSLTQVKSELPMVCHKSITLRCPSKTKGSLMRYLIETESPEKLELID
GVKIKENHTDNWVLILPDGGEPLVHVYANSDSREWVDEHLQVYRDKVQSFIIQQHSL
NT seq 2514 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgctgttttaatggctggaggttctgggacaaggttacgtccattgacttgtaac
ctacctaagccgatggttccagttttaaacagacccattgcagaacacatcattaatttg
cttaagcgtcatggtattcatgaaattattgctactctccattatctccccgatgtgatg
cgagattattttcaagatggtcgagattttggcgttaccctcaactatgctgttgaagaa
gaacaacctttaggtactgctggttgtgtgaaaaacattgaagaaatgctcgatgatact
tttttggtcattagtggtgacagtattgctgattttaatttacaggatgcgatcgcattt
caccgagccaaaaaatcaaaagcaactttaattttgaccagagtaccaaatccccttgag
tttggagttgttattaccgatcaggaaaacagaatccaaagatttttagaaaaaccctcc
gccagtgaaattttttctgataccgtcaatactggtacttatatattagaacccgaagtc
ttaaaatatctgccccaagatgaagaatgtgatttttccaaagatttgttccctcaactg
ttggaaatggaagaaccgatgtatggttatattgctgatgcttattggtgcgatgtggga
catttagaagcctatcgagaggcacattattcagcactagaaaaagaagttgaattacaa
tttccctatcgagaaatagaccaaggagtgtggattggcgaaaatacctatattcatccc
actgccattgtggaaagtcctgtcttaattggtagtaactgtcgtatcggtgaaagagca
aagattcttgctggtacaattattggtgataatgtgaccattggtgacgatgcagaactt
catcgaccgattatttggaatggcgttattgtgggcgaagaatcttctttatcagcttgt
attatagcacgagggacaaggatagatcggcgatcgcaaattttagaaggagcagtaatc
ggttctctgtgtaatattggcgaagaatcccagattaacatcggtgtcagagtttggcct
aacaaaagaattgagccgggggcaatgcttaatattaatctgatttggggaaatatagcc
catagtaacctctttggacaaaggggggtaacgggactcgcaaacattgacattacccca
gaatttgccgttaaattgggagcggcttatggttcaaccttaaaatcaggtagtagtgtt
gttgtctccagagatcaacgcaccgtatcaagaatggtgagtcgctctttaattgcaggt
ttaatgtctgtaggcatagatgtacagaatttagaagcggcggcaattcccatttctcga
accatgactcccaagttaggagtagcgggaggaattcatgtgaggttgcatcccgatcgc
catgactatatgttaattgaattttttgataccaatggaattaatatttccaaagccaaa
gaaaagaaaattgaaggagcttattttaaggaagacttaagaagagtacaagccattgat
attggtgatatgtcatatcctgcccaagtagtggatacataccgcaaaacctttgaaact
caacttaatttagaggctattcgtaatagtgacacaaaaattgtcattgattatgtttat
tcagtttccggggcaatcttaccgcaactattggcaaaatttggttgtgatgccgttgtt
ttgaatgctagtcttcgtcaaagggcaatttctaacattgaaagggaaaatttgctttct
caattaggtcatgtggtagaggctctaaaagcaaactttggagtccaagtatcagctaat
ggtgaattattaattttagtagatgaatcaggtattcaaattcgaggggaagaattaaca
gctctgatggtaaatacaattctcacggcacatcctagaggcactgttgttgtccccatg
aatacatcctctgcggtggaacaaattgcccgtcgtcacgatggtaaagttattcgcaca
aaagtcaatcccagtgctttaatggaaaccagtcaaaatactcccaatgtggttttagga
ggaagtggagacatggggtttatttttccgaagttgcaccccggttttgatgcgatgttt
accattgccaaattaatagaaatgctaactgttcaagagcgctctttaacacaggtaaaa
agtgaattaccgatggtttgtcataaatccattactcttcgttgtccttctaaaacgaaa
ggctcactaatgcgttatctcattgaaaccgaatcccccgaaaagttggaactaattgat
ggagtcaagatcaaagaaaatcatactgataattgggttttaattttacctgatggtggc
gaacccttagtacatgtttatgctaatagtgatagtagagaatgggtggacgaacatttg
caggtatatcgagataaagtccaaagttttattattcaacaacatagcctttaa

DBGET integrated database retrieval system