KEGG   Cyanobacterium aponinum: Cyan10605_2562Help
Entry
Cyan10605_2562    CDS       T02376                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
can  Cyanobacterium aponinum
Pathway
can00330  Arginine and proline metabolism
can00332  Carbapenem biosynthesis
can01100  Metabolic pathways
can01130  Biosynthesis of antibiotics
can01230  Biosynthesis of amino acids
Module
can_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:can00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Cyan10605_2562
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Cyan10605_2562
Enzymes [BR:can01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Cyan10605_2562
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AFZ54642
UniProt: K9Z7C6
Position
complement(3045051..3046163)
Genome map
AA seq 370 aa AA seqDB search
MSKTIVVKIGTSSLTRLETGNLALSTIASLVETLTNLRQQGNRVILVSSGAVGVGCGRLC
LTERPRNINIKQAIAAVGQGRLIRVYDDLFSNLGQPIAQILLTRRDLMDRNSYVNANNTF
NALFELGVIPIVNENDTVATDELKFGDNDTLSALVASLVEADWLFLLTDVDKLYSADPRI
VPSAVPIDLVNSDEFAQLEINVSEGGSGWGTGGMITKLRAAKIASSAGVTTVITNGKTPY
NISKIIAGEAIGTKFTAQPKTENARKRWIANGLVSTGRIHLDDGAVNALCKQGKSLLAAG
ITTIEGNFSVSDAVDLINSQGEIIGKGIVNYSYDDLDLVKGQKSANISQILGYQTPETVI
HRDNLVIFDN
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaaactatagttgtcaaaattggcacttctagcttaaccagactggaaacaggt
aatttagccctttcaactattgctagtttagtggaaactctcacaaatttacgtcaacaa
ggtaatcgggttattctcgtttcttctggagcggtaggagtaggctgtgggagactttgt
ttgactgaacgccctcgtaatattaacataaaacaagcgatcgcagccgttggacaagga
agattaatcagagtttatgatgatttatttagtaacctcggacaacccatcgcccaaatt
ctcttaactagaagggatttaatggatagaaactcctatgtaaatgcaaacaatactttt
aatgctttgtttgagttaggagtaattcccatcgtcaatgaaaatgatactgttgctacg
gatgaattgaaattcggagataatgacactctttcggcattagtagcgagtttagtagaa
gcggattggttatttttattaacggatgtggacaaactttattcggcagaccctcgtatt
gtaccctctgccgttcctatcgatctagttaatagtgacgaatttgcccaactggaaata
aatgttagtgaaggaggtagtggttggggtactggtggtatgattacaaagttaagggcg
gcaaaaattgcttctagtgctggagtaacgacggttatcactaacggaaaaacaccctat
aatattagcaaaattatagcaggagaggcgatcgggacaaaatttacggctcaaccaaaa
acagaaaatgctcgtaaacgttggatagcaaatggcttagtttccacgggtagaatccat
ttagatgatggggcagttaatgctctttgtaaacaaggaaaatctttactggcggctgga
attactactatagaaggcaattttagcgtttctgatgctgtggatctcatcaattctcag
ggagagattatcggcaagggtattgttaattatagttatgatgatttagatttagtcaaa
gggcaaaaatccgccaatatttcccagattctaggttatcaaacccctgaaactgttatt
catcgagataatctagttatttttgataattaa

DBGET integrated database retrieval system