KEGG   Cyanobacterium aponinum: Cyan10605_2924Help
Entry
Cyan10605_2924    CDS       T02376                                 

Definition
(GenBank) pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
can  Cyanobacterium aponinum
Pathway
can00790  Folate biosynthesis
can01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:can00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Cyan10605_2924
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:can04147]
    Cyan10605_2924
Enzymes [BR:can01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     Cyan10605_2924
Exosome [BR:can04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Cyan10605_2924
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a IF-2 DUF1102
Motif
Other DBs
NCBI-ProteinID: AFZ54986
UniProt: K9Z713
Position
3475558..3475941
Genome map
AA seq 127 aa AA seqDB search
MLPILYFSLLDSSCLTLEKSNVIIESKLIITQNMVLNETEVRQKLANYPNWVTSGQSINT
TYKFKDFIQAVEFVNRLVEPAERAGHHPDIEISYNKVTIHLTTHDAGGITQKDFDLAEEI
QRIIKGF
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgctacctattctttatttctctttgctcgattctagttgtttaacattagagaaaagt
aacgttattatagaatcgaaactcattattacgcaaaacatggttttaaacgaaacagaa
gtcagacaaaaactagcaaattatcctaattgggttactagcggacagtctattaatact
acctacaagtttaaagactttattcaagccgttgaatttgtcaatcgtctggttgaacca
gcagaaagagcaggacatcatcctgacatcgaaatatcttataataaggtaacaatccat
ttaacgactcatgatgctgggggaattactcaaaaggattttgatctagctgaggaaatt
caaagaatcattaagggtttttaa

DBGET integrated database retrieval system