KEGG   Cyanobacterium aponinum: Cyan10605_3401Help
Entry
Cyan10605_3401    CDS       T02376                                 

Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
can  Cyanobacterium aponinum
Pathway
can00010  Glycolysis / Gluconeogenesis
can00020  Citrate cycle (TCA cycle)
can00620  Pyruvate metabolism
can01100  Metabolic pathways
can01110  Biosynthesis of secondary metabolites
can01120  Microbial metabolism in diverse environments
can01130  Biosynthesis of antibiotics
can01200  Carbon metabolism
Module
can_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:can00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cyan10605_3401
   00020 Citrate cycle (TCA cycle)
    Cyan10605_3401
   00620 Pyruvate metabolism
    Cyan10605_3401
Enzymes [BR:can01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Cyan10605_3401
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding AATase DUF4781 PYNP_C PASTA MadL
Motif
Other DBs
NCBI-ProteinID: AFZ55443
UniProt: K9ZAM2
Position
4018705..4020030
Genome map
AA seq 441 aa AA seqDB search
MIYDIFMPALSSTMTEGKIVSWEKQPGDKVEKGETVVVVESDKADMDVESFYSGYLATIL
VPAGSQAPVGDAIAYIAETEAEIEEAKKKASQAQGGNNVTSTPATTPEFKKEVETSPQPV
ATTANTEISPSNTSENNGRIIASPRAKKLAKEFKVDLATIKGSGVNGRITAEDVEKAVGK
APSVTTSTPSLPTITSSIPPQITPTPALGNAAPINNLAGETVPFNTLQQAVVRNMVASLH
VPTFQVSYDITTDALDGLYRKIKTKGVTMTALLAKAVAVTLQKHPIMSATYTEGGIKYND
SINIAVAVAMPDGGLITPVIKNAAQIDIYSLARSWKDLVDRARAKQLQPDEYSTGTFTLS
NLGMFGVSSFTAILPPGQGSILAIGGTRPAVVASKDGLFGVKNQMTVTITCDHRIIYGAD
AASFLKDLANLIENDPHSLTL
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgatttacgatatatttatgccagccctcagttccacgatgacagaagggaaaatagtt
tcatgggaaaaacaacccggtgataaagttgagaaaggagaaactgttgttgtcgttgaa
tccgacaaggctgatatggatgtagaatctttctactctggttatttagctactattctt
gtccctgccggttctcaagctcctgtgggagatgcgatcgcatatattgctgaaaccgaa
gcagaaatagaagaagccaagaaaaaagccagtcaagcacaagggggaaataatgtcact
tcaacccccgcaactactcctgaattcaaaaaagaagtagaaacctctcctcaacctgtg
gcaaccactgctaacacagaaatctctccctcaaatacttctgaaaataacggtagaatt
atcgcttcccccagagcaaaaaaattagccaaagaatttaaagttgatttagccactatt
aagggtagcggtgtcaacggtagaattaccgccgaagatgtagaaaaagcggtcggaaaa
gcacctagcgtaaccacatctactccttcattgcccaccattacatcctctatacctcct
caaattacccccactcctgccctcggtaatgccgctcccattaataatttagcaggagaa
accgtaccttttaacaccttacaacaagcagttgttcgtaatatggtggctagtttacac
gttcccactttccaagttagctatgatattaccactgatgctttagatggcttatatcgt
aaaatcaaaactaagggagttacaatgactgcattattagccaaagctgttgcagttacc
ctacaaaaacaccccatcatgagtgctacttatacagaaggtggcattaaatataacgat
tctatcaacatcgctgttgccgttgcgatgcccgatggcggtttaattacccctgtgatt
aaaaatgcggctcaaatagatatttattcccttgcccgtagctggaaagatttagtagat
cgtgccagagcaaaacaactacagcctgatgagtacagtacaggtacatttactctttct
aatttagggatgtttggtgtaagtagctttaccgctattttacctcccggacaaggttcg
atcttagccattggtggtactcgccccgccgtagtagctagtaaagacggtttatttggg
gttaaaaatcaaatgacagtgactatcacctgtgatcaccgtatcatctatggtgcagat
gcggcatcattcctcaaagatttagctaatttaattgaaaatgatccccattctttgaca
ttgtag

DBGET integrated database retrieval system