KEGG   Cyanobacterium aponinum: Cyan10605_3408Help
Entry
Cyan10605_3408    CDS       T02376                                 

Definition
(GenBank) Glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
can  Cyanobacterium aponinum
Pathway
can00561  Glycerolipid metabolism
can00640  Propanoate metabolism
can01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:can00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Cyan10605_3408
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    Cyan10605_3408
Enzymes [BR:can01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     Cyan10605_3408
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase AIRC PFK
Motif
Other DBs
NCBI-ProteinID: AFZ55450
UniProt: K9ZA29
Position
complement(4026967..4028082)
Genome map
AA seq 371 aa AA seqDB search
MSKSKSISIEVGQIFSLQVAPGNIIKGENSLSNSGDAIASFGQMPLVVGGEKTIKLIETY
LEPICKKFNLKPRYASYLPDCSETSLKRLEKAVKTHEADFIIGVGGGKSLDSAKLLAHNC
HLPVITIPTSGATCAAWTALSNIYSESGAFQYDVSLRHCPNLLILDYNIIASAPKYTLIA
GIGDAIAKWYEASVSSGNSTATLTIAAVQQARVLRDILLQKAETALQNPLSETWKEVVDA
TVLLAGVSGGLGGANCRTVAAHAVHNGLTHLEATHGKLHGAKVAYGILVQLRLEETIANN
QLAKTARQQLIKFYQSIGLPITLEDLGLTNITLNQLRQCAEITCKPESDIHRLPFNVTPD
ILLSAMVSTMA
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaatcaaaatcaattagcattgaagttggtcaaatttttagcttacaggttgca
ccggggaatattattaaaggagaaaacagtctcagtaatagtggggatgcgatcgcatct
tttggtcaaatgcccttagtggtgggaggagagaaaactataaaattaattgaaacttat
cttgaacctatttgtaagaaatttaatttaaaacctcgttacgctagttatcttcccgat
tgtagtgaaacatctttaaaacgtctcgaaaaggcagtcaaaacccatgaagccgatttt
atcatcggtgtggggggaggaaaatcccttgatagtgcaaaattattagctcataattgc
catttaccagtaattaccattcctacctctggggctacttgtgccgcttggactgcttta
agtaatatttattcagaatcgggagcttttcaatatgatgtaagtttacgtcattgtcct
aatttacttattctcgattacaatattattgcttctgctcctaaatataccctgatagca
ggaatcggagatgcgatcgcaaaatggtatgaagcctccgtcagtagcggtaactctacc
gcaaccttaaccattgccgctgtacaacaagcaagagtattgagagatattttactccag
aaagccgaaactgctttacaaaatcccctcagtgaaacttggaaagaagtagttgacgca
acagtattacttgcaggagtaagcggaggtttgggaggtgcaaattgtcgaaccgttgcc
gcccatgccgtgcataatggtttaacccacttagaagcaactcacggcaaattacacggt
gcaaaagtggcttatggtattctggtgcaattgagattagaagaaaccatcgctaataat
caacttgccaaaactgccagacaacaattaatcaagttttatcagtctatcggtttacct
attaccttagaagatttaggcttaacaaatattaccttaaatcaactgcgtcaatgtgct
gaaattacttgtaaaccagaatcagacattcaccgtttaccttttaatgtgactcctgat
attttactcagtgcaatggtttcaacaatggcataa

DBGET integrated database retrieval system